KEGG   Taylorella asinigenitalis MCE3: TASI_1319Help
Entry
TASI_1319         CDS       T01634                                 

Definition
cytochrome c551 peroxidase
Orthology
K00428  
cytochrome c peroxidase [EC:1.11.1.5]
Organism
tas  Taylorella asinigenitalis MCE3
Brite
Enzymes [BR:tas01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.5  cytochrome-c peroxidase
     TASI_1319
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1370289..1371398)
Genome map
AA seq 369 aa AA seqDB search
MKLASKLLITCMAAAFASTAMAAERYKPDNELIEPIKPAKIENQAEVDLGAKLYFDPRLS
RSGFISCNSCHNLSMGGTDNLQTSIGDKWQQGPINAPTVLNSTLNFVQFWDGRAKDLKEQ
AGGPIANPGEMAFTHDLAVGLLNSIPQYVEEFKKVYGKEKIDIDQVTQAIAAFEDTLVTP
NSRFDQWLQGKDDAITDQELKGYLTFRDAGCVACHNGAAVGGSTYQKMGVVDIYVTDNES
AGRAGVTGEDIDRMMFKVPTLRNVELTYPYFHDGAANTLKEAVEIMGRLQLGKKFTEEEN
ANIVAFLKTLTGDQPDMKLPIIPPSSDATPRPNPWAEIAKADVMKKEEPKAEEKKEEPKA
EDKKEAPKA
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagcttctaagttgttaattacctgtatggccgcagcttttgcttcaactgca
atggctgctgagagatacaaaccagataatgaattaattgaaccaatcaaaccagcaaaa
atcgaaaatcaagctgaagttgatttaggagctaaattatatttcgatcctcgtttatct
cgttctggatttatttcttgtaactcttgtcacaacctatctatgggtggtactgataat
cttcaaacatctatcggtgacaaatggcagcaaggtcctattaacgcacctacagtatta
aactcaactcttaactttgttcaattctgggacggtcgtgcaaaagaccttaaagagcaa
gctggtggtcctattgctaacccaggtgaaatggcgtttactcacgacttagctgttgga
cttttaaactcaatccctcaatatgttgaagagttcaaaaaagtatacggtaaagaaaaa
atcgatatcgaccaagttactcaagcaattgcagcatttgaggatactttagttactcca
aactctcgttttgaccaatggttgcaaggtaaagatgatgctatcactgatcaagaactt
aaaggttatttaactttcagagatgctggttgtgtagcttgccataatggtgcagcagta
ggtggttctacttatcaaaaaatgggtgtagtggatatctatgttacagataatgaatct
gctggtcgtgctggtgttactggtgaagatatcgatcgtatgatgtttaaagtccctaca
cttcgtaatgttgaattaacatatccgtacttccatgacggtgcagctaatactcttaaa
gaagctgtagaaattatgggtcgtttgcaattaggtaaaaaattcactgaagaagaaaac
gctaatattgtggcattcttaaaaacattgactggtgatcaacctgatatgaaacttcct
attatccctccatcaagcgatgctactccacgtcctaatccatgggctgaaattgcaaaa
gctgatgtcatgaaaaaagaagagcctaaagctgaagagaaaaaagaagagcctaaagct
gaagataaaaaagaagctcctaaagcctaa

DBGET integrated database retrieval system