KEGG   Taylorella asinigenitalis MCE3: TASI_1557Help
Entry
TASI_1557         CDS       T01634                                 

Definition
(GenBank) Arginase
  KO
K01476  arginase [EC:3.5.3.1]
Organism
tas  Taylorella asinigenitalis MCE3
Pathway
tas00220  Arginine biosynthesis
tas00330  Arginine and proline metabolism
tas01100  Metabolic pathways
tas01110  Biosynthesis of secondary metabolites
tas01130  Biosynthesis of antibiotics
tas01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:tas00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    TASI_1557
   00330 Arginine and proline metabolism
    TASI_1557
Enzymes [BR:tas01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     TASI_1557
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: AEP37295
UniProt: G4QBV0
Position
complement(1613620..1614531)
Genome map
AA seq 303 aa AA seqDB search
MNKKIALVGVPTDVGAGHRGSSMGPEALRVAGISDRLLAMGFEVLDRGNLHGPVNPVRPP
EGGYRNFEEVVTWNRLTHDAMYDELKQGNLPIMLGGDHCLAAGSISAVSRYCREAGKKLR
VIWLDAHTDFNTFESTPSGNMHGMPVACLFGRGPREMIELSGVVPALTSDQIFQIGIRSV
DTIEKVMVHEAGYPVFDMRKLDEIGMREAMEYALEGLTDEYHLHVSFDVDFLDPEIAPGV
GTTVRGGPDYREAQLCMEMIADTGLVASLDIVELNPALDVQNLTANIACELVESLFGKNT
LVR
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaaaatcgcattagttggtgtacctacagatgttggtgctgggcataggggc
tcatcaatgggccctgaagctcttcgcgtagcaggaataagtgatagattacttgcgatg
ggatttgaagttttagatcgtggtaatcttcatggacccgttaatccagtgcgtccgcct
gaaggtgggtatcgcaatttcgaggaagtagttacttggaatcgcttaacgcacgatgcc
atgtatgatgagctaaaacaaggcaatctcccaatcatgctcggaggcgatcattgtctt
gctgcgggttcaattagtgcggtttctcgatattgtcgtgaagctggaaagaagcttcgt
gtgatatggcttgatgctcatacggactttaatacatttgagtctacaccaagcggaaat
atgcatggcatgcctgtggcttgcttgtttggccgtggccctcgtgaaatgatcgaatta
agtggagttgttcccgccctcacatccgatcaaatttttcaaatcggcatacgaagcgta
gacacaatcgagaaggtgatggtgcatgaagcgggctatcctgttttcgatatgcgcaag
ctcgatgagataggtatgcgtgaagctatggaatatgctctagaggggcttactgatgaa
tatcatttacacgtgagttttgatgtggattttctagatccagagattgctcctggagtt
ggtacaacagttcgtggaggccctgattatcgcgaagcacagctttgcatggagatgatt
gcggacacgggtcttgtagcatctcttgatattgttgaactaaatcctgcacttgatgta
caaaaccttacagctaatatagcttgcgaacttgtggagagtttgtttggtaaaaataca
ttagttcgatag

DBGET integrated database retrieval system