KEGG   Taylorella asinigenitalis 14/45: KUM_0807Help
Entry
KUM_0807          CDS       T02603                                 

Gene name
hemD
Definition
uroporphyrinogen-III synthetase
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tat  Taylorella asinigenitalis 14/45
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:tat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KUM_0807 (hemD)
Enzymes [BR:tat01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     KUM_0807 (hemD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(854614..855396)
Genome map
AA seq 260 aa AA seqDB search
MLHLVLTSNSERNSKLICALKHLMSATFHNMPALKIMPLIPPQDILSSDLISSLQYVFFV
SKNAVAIFFKNYEKYAKALPTQIKFLCVGPGTASEIRKYSAADAEIIFPENDVHDSYSLY
LKIHKLVRPNSKILIVKGEGGREFFKTAMSKDGHEIYELEIYKRLSKDYSGHEMSIFSNL
DSQDDLAILFTSPDGIKGLMPQLEKYCKPELLKRTLYLILHENHRDLLPNKKCEIVSLEA
NIIHAKLASIFEPMKYNIKH
NT seq 783 nt NT seq  +upstreamnt  +downstreamnt
atgcttcacttggtattaacgagtaattctgagcgtaattctaaattaatttgcgcatta
aaacatttgatgagtgcaacgtttcataatatgcccgcactcaaaataatgccgttaata
cctcctcaagatatcctatcatcggatttaataagttcacttcaatatgttttttttgta
agtaaaaacgccgtagcaattttttttaaaaattatgagaaatatgcaaaggcattgcca
actcaaattaaatttctatgcgtaggccctgggacggcaagtgaaataagaaaatattct
gcagcagatgcggaaattattttccctgaaaatgatgttcatgattcttattctttatat
ttaaaaatccataaactcgtcagacccaatagtaagattcttatcgtaaagggagagggt
ggtcgtgaattctttaaaactgctatgtctaaagacggtcatgaaatctatgaactagaa
atttataaaagacttagcaaggactattcggggcatgaaatgtcaattttttctaatttg
gactctcaagatgatttagctattctgtttacgagtccagatgggattaaggggctgatg
ccacaattagagaaatactgtaagcctgaattgcttaaaaggaccctatatcttattttg
catgaaaatcatagggacttattgccaaataaaaaatgtgaaattgtgagcctagaagca
aatataattcatgcaaaattggcctctatattcgaacctatgaagtacaatataaaacat
taa

DBGET integrated database retrieval system