KEGG   Taylorella asinigenitalis 14/45: KUM_1083Help
Entry
KUM_1083          CDS       T02603                                 

Definition
alkaline phosphatase ec=3.1.3.1
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tat  Taylorella asinigenitalis 14/45
Pathway
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tat00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    KUM_1083
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KUM_1083
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    KUM_1083
Enzymes [BR:tat01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     KUM_1083
Exosome [BR:tat04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KUM_1083
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(1136253..1138220)
Genome map
AA seq 655 aa AA seqDB search
MQKKWMKSVLATSVLAGLCMGAVATAKITDIVPVDQKAFDIVKTRMENSVEKTGIAIMPI
DQAKFLKGQRFDFEVEVLDETAESVEVTLNGKSFKDIFGGDLKRIENATKDGKKYVSFRA
ENVSIASVGDIELVVKAKTASGEKTRKVMWSVVGDVADKKAKNVILFVGDGMSLQAKQAA
RILSKGIYEGRYNNLLAMESLPDAAIVSTSGYDSIVTDSANSASAYNTGHKSVVNAMGVY
ENRTPDTLDDPKVETISEIIKRTRGMSVGIVTTSSVTDATPAAVTAHTRRRGDQDYIAHD
FIADHHRPDVILGGGIRYFVPKAQAGSKRKDETDVIKEFEAKGYTFAGNRAEMNAASNDK
PLLGLFASNHMDVYIDREHIPNKEVTKGFDDQPNLVEMTKKAIDIVSKNPNGFYLMVEGA
SVDKQLHTMDWQRAIYDAIELDKAVEFAKNWSKENGDDTLIVVIADHGHGISITGTYTEA
DGRKGREAVRTYAESKFPGFVDADGDGFPEDPNPEITLAIQYANFPDHYENYRFQTKPTP
PALAAKDADGKQSIKANPARAPEGARLIEGNLPSDKETQEVHSADDIIVMAGGPGSDYFR
GHIENTEIFFGIMRALGIDAVSEKAQASNDKQDMESEVKTEETKSEKKAEEKPAQ
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaagaaatggatgaaatctgtgcttgcaactagcgttttagctggtttgtgcatg
ggtgcagtagctactgcaaaaattactgacattgtgccagtagatcaaaaagcgtttgac
attgttaaaacacgtatggaaaacagtgttgaaaaaactggcattgctattatgcctatc
gatcaagctaaattcttaaaaggtcaacgttttgactttgaagttgaagtgttagatgag
acagcagagtctgttgaagttactttaaacggtaaatctttcaaagatatcttcggtggc
gatttaaaacgcatcgaaaatgctactaaagacggtaaaaagtatgtttctttccgtgca
gaaaatgtttcaattgccagtgttggtgatatcgaactagtagttaaagctaaaactgct
tctggcgaaaaaactcgtaaagttatgtggtctgttgtgggcgacgttgcagataaaaaa
gctaaaaacgttattctttttgttggtgacggcatgagccttcaagctaaacaagctgct
cgcattctttctaaaggtatttacgaaggtcgttacaacaaccttttagcaatggaatca
cttccagatgctgctatcgtatcaacatcgggttatgattctatcgtaactgactcagct
aactctgcttctgcgtacaacactggtcacaaatcagtagttaatgcaatgggtgtatac
gaaaaccgcactccagacactcttgatgatcctaaagttgaaactatttcagaaatcata
aaacgtacaagaggtatgtctgttggtatcgtaactacttcttctgtaactgacgctact
ccagctgctgtgactgctcacactcgtcgtcgtggtgaccaagactatatcgctcatgac
tttattgctgatcatcatcgtccagacgtaatacttggtggtggtattcgttatttcgtt
cctaaagcacaagctggttctaaacgtaaagacgaaactgatgtaattaaggaattcgaa
gctaaaggttacaccttcgctggtaaccgtgcagaaatgaatgccgcttctaatgacaaa
cctttattaggtcttttcgcttctaaccatatggatgtttacatcgatcgtgaacatatc
cctaataaagaagtaactaaaggttttgatgatcaacctaacctagttgaaatgactaaa
aaagcaatcgatatcgtttctaaaaaccctaatggtttctatttaatggttgagggtgct
tctgtagataaacaacttcacactatggattggcaacgtgcgatttacgatgctatcgaa
ttagataaagcagttgaatttgctaaaaactggtctaaagaaaacggtgatgatactcta
atcgtagttattgctgaccatggtcacggtatttcaatcactggtacatacactgaagct
gacggcagaaaaggtcgtgaagctgtacgtacttatgcagaatccaaattccctggcttt
gtagatgctgacggtgacggattccctgaagatcctaaccctgaaattacattggctatt
caatacgctaacttcccagaccactacgaaaactatcgtttccaaactaaacctacacct
ccagctttagctgctaaggatgctgatggtaaacaatctatcaaagcaaacccagctcgc
gctcctgaaggtgctcgtttaatcgaaggtaacctacctagcgataaagaaactcaagaa
gttcactcagcagacgatattatcgttatggctggtggtccaggatctgactacttcaga
ggtcacattgaaaatacagaaatcttcttcggtattatgcgtgcactaggtatcgatgct
gtatctgaaaaagcacaagcttctaacgataaacaagatatggaatctgaagttaagact
gaagaaactaaatcagaaaagaaagctgaagaaaaaccagctcaataa

DBGET integrated database retrieval system