KEGG   Taylorella asinigenitalis 14/45: KUM_1372Help
Entry
KUM_1372          CDS       T02603                                 

Definition
putative disulphide bond isomerase
Orthology
K03981  
thiol:disulfide interchange protein DsbC [EC:5.3.4.1]
Organism
tat  Taylorella asinigenitalis 14/45
Brite
Enzymes [BR:tat01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.4  Transposing S-S bonds
    5.3.4.1  protein disulfide-isomerase
     KUM_1372
Secretion system [BR:tat02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KUM_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1445678..1446517
Genome map
AA seq 279 aa AA seqDB search
MKLKFNSIFAVLALSSFASVVAAQNAAVVPPMGAVEKAPVEQTKAEKAEATSEKSNVEKA
GALPQEKINAITSNIEKSFGVKVLEVNATPYTGLYEVLTNETIVYTDADSSFILAGHLFD
TKTTDNLTQQRVKEQSAKAFAKLPVGEAVKRVKGKGTRKLVTFEDPNCRYCKALYKELEQ
MDDVTIYTFLVPILAKDSVTKVRDIMCSSNPALAWHEWVEKGQKPAPQSKANCEEPNPKT
LDLARSVDVRGVPVILFPNGERRNGFVRLSEIEEIISQK
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
gtgaaattaaaatttaattctatatttgcggtgcttgctttgtcttcatttgcttctgtt
gtagcggctcaaaatgcggctgtggtgccgcctatgggggccgtggagaaagcacctgtt
gaacaaactaaagcggagaaggctgaggcgacttcggaaaaatcaaatgtggagaaagcg
ggggcattgccacaagagaaaattaatgcaattacatctaacatcgaaaaatcttttggc
gtaaaggtgcttgaagtgaatgccactccatatacgggcctgtacgaggttttgacaaat
gagactattgtctacacagatgcggatagttcgttcattcttgctgggcatttatttgat
acgaaaacgaccgacaatcttactcaacaacgcgtgaaagagcagtcggcaaaggcgttt
gcaaaattgcctgtgggtgaggctgtcaagcgcgtcaagggcaagggtactagaaaactt
gtgacatttgaggatccgaattgcagatattgtaaggctctatataaggagcttgagcaa
atggatgatgtaactatatacacttttctagtgcctatattagctaaggattctgtaact
aaggtgcgtgatattatgtgctcatcgaatcctgcattagcatggcatgaatgggtcgaa
aagggccaaaagcctgctcctcaaagcaaagcgaattgcgaagagccgaatcctaaaact
ctcgatttagctagaagcgtggatgtaaggggtgttccagtgattttatttccgaacggg
gagcgtcgaaatggttttgtgcgtctctctgaaatcgaagagataatttcacaaaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system