KEGG   Tolumonas auensis: Tola_0009Help
Entry
Tola_0009         CDS       T00904                                 

Gene name
glyQ
Definition
glycyl-tRNA synthetase subunit alpha (EC:6.1.1.14)
Orthology
K01878  
glycyl-tRNA synthetase alpha chain [EC:6.1.1.14]
Organism
tau  Tolumonas auensis
Pathway
Aminoacyl-tRNA biosynthesis
Module
Aminoacyl-tRNA biosynthesis, prokaryotes
Class
Genetic Information Processing; Translation; Aminoacyl-tRNA biosynthesis [PATH:tau00970]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(13160..14074)
Genome map
AA seq 304 aa AA seqDB search
MQKFDIKTFQGLILSLQDYWARQGCVISQPLDMEVGAGTSHPMTFLRSIGPEPMNCAYVQ
PSRRPTDGRYGENPNRLQHYYQFQVILKPSPDNIQELYLGSLRELGFDPLVHDIRFVEDN
WENPTLGAWGLGWEVWLNGMEVTQFTYFQQVGGLECFPVTGEITYGLERLAMYIQGVDSL
YDLVWADGPLGKVTYRDVFHQNEVEQSTYNFEHADVPFLFQLFDQCEKECQHLLNLELPL
PLPAYERILKAAHAFNLLDARHAISVTERQRYILRIRTLSKAVAEAYYAARERLGFPMCK
ATQA
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgcagaaatttgatatcaaaacatttcagggactcattttatccctgcaagattactgg
gcccgccagggttgtgttatttcacaaccgctcgatatggaagtgggtgctggtacttca
catccaatgactttcttacgctccattggtccggaaccgatgaactgtgcttacgtgcag
ccatcccgtcgtccgaccgatggtcgctacggtgaaaaccctaaccgtttgcaacactac
tatcagtttcaggtcattctgaagccgtccccggataacatccaggaattgtatctcggt
tcactgcgtgaactgggttttgacccgctggtccatgatatccgttttgttgaggataac
tgggaaaacccaacactgggcgcctggggcttaggctgggaagtctggctgaacggtatg
gaagtgacgcagtttacttacttccagcaagttggtggcttagagtgcttcccggtgacc
ggtgaaatcacttacggtctggaacgtctggcgatgtatatccagggcgtggacagtctg
tatgatctggtctgggctgacggtccgctgggtaaagtaacctaccgtgacgtgttccat
cagaatgaagtagaacagtctacttacaacttcgaacatgccgatgtaccgttcctgttc
cagttgttcgatcagtgtgaaaaagagtgtcagcatctgctgaacctggagcttccactg
ccattgccagcttatgaacgtattctgaaagcggctcatgcctttaacctgctggatgcc
cgtcatgcgatttctgtgactgagcgtcagcgctacatcctgcgtatccgtacgttatcc
aaagcggtggctgaagcctattacgccgcccgcgaacgtctcggtttcccgatgtgcaaa
gcaactcaagcgtaa

DBGET integrated database retrieval system