KEGG   Tolumonas auensis: Tola_0043Help
Entry
Tola_0043         CDS       T00904                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tau  Tolumonas auensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Tola_0043 (malQ)
Enzymes [BR:tau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.25  4-alpha-glucanotransferase
     Tola_0043 (malQ)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(52148..54268)
Genome map
AA seq 706 aa AA seqDB search
MDISVIEAAAKAAGIADSYISALGQPVQIAISTQEKILAALGHTSPENNLLPAVSVFRQG
ELFRVLLQDAVTDTCHWRLQPESGKPLRGVLANGFLTLPDNLPLGYHKLCLLQGRKVIAE
SRIIIAPARCYEPPAIQQGKKTWGACVQLYTLRSEENWGIGDFADLKQMVTALAAQGADF
VGLNPLHALYPASPDSASPYSPSSRRWLNIIYIAVHKLPDFQLSSAAQLWWQNPEIQQQL
QAARASDYVDYPQVTALKLAGLKLAYQYFASLPDDIPRVGEFEQFRRQQGESLQQQATYD
ALHAWLKQQDEHAWGWPAWPAEYQQWESPALQLFRQEHADEIRFYAWLQWLTQGQLQECQ
QSARDAGMLIGIYRDLAVGVTEGGTETWCDRELYCLKASVGAPPDILGPLGQNWGLPPMS
PQVMRQRGYQPFIDLIQSNMKACGALRIDHVMGLLRLWWVPQGSTAVEGAFVSYPVDDLL
AILALESQRHQCMVIGEDLGTVPDEIVAKLRDNGVYSYKVFYFERAPAPDSGFYSPRDYP
AQAMTTLSTHDMPTLYGYWQADDLTLGQKLGLYPDAEVLSGLYADREQAKQRMLDSLHSL
HSLPEEYSRQAQGMMMNPALNRGIHCHVAQSNSALLGLQPEDWLNMTMPVNIPGTTHEIY
PNWRRKLSCTLEAMFNDSDVISLLAEINRRRRQLYPNNLELQVGGK
NT seq 2121 nt NT seq  +upstreamnt  +downstreamnt
atggatatttctgtaattgaagcggccgcgaaagcggccggtattgccgacagttacatc
agtgcgctcggtcagccagtgcagatcgcgatcagcactcaggaaaaaattctggcggcg
ctgggtcatacctcgccggaaaataatctgctgccggcagtcagtgtgttccggcaaggc
gaactgttccgcgtcctgctacaggatgcggtgacggatacctgccactggcgtttacag
ccggaaagcggcaaaccgctgcggggtgtgctggccaacggtttcctgacgctgccggat
aatctgccgcttggttaccacaaactctgcctgctgcaggggcgcaaagtgatcgccgaa
agccgcatcatcattgcacctgcccgctgctatgaaccaccggcgatccaacagggcaag
aaaacctggggcgcctgcgtacagttgtatacgctgcgttcggaagaaaactggggcatc
ggcgattttgccgatctgaaacagatggtcaccgcactggccgcacaaggggcggacttt
gtcggtctgaatccgctgcatgcgctgtatccggccagtcccgacagcgccagcccgtac
agcccctcttcccgccgctggctgaatatcatctacatcgccgtacataaactgccggat
tttcagctcagttctgccgcacaattgtggtggcaaaatcctgaaatacagcaacaactg
caggccgcccgtgccagcgactatgtcgattatccgcaggtcaccgcgctgaaactcgcc
ggactgaaactggcgtatcagtattttgcctcactgccagatgacattcctcgcgtcggt
gaatttgagcagttccgcaggcaacagggggaaagtctgcagcagcaagccacttacgat
gccttgcacgcctggctaaaacagcaggatgagcacgcctggggctggccggcatggcct
gctgaatatcagcaatgggaaagtccggcactgcagctattccgccaagaacatgcagat
gagatccgtttttacgcctggctgcaatggctgacacagggtcagttgcaggagtgtcag
caaagcgcgcgcgatgccggcatgctgatcggtatctaccgtgacctcgcggtcggcgtc
accgaaggcggcactgaaacctggtgtgatcgcgaactgtattgcctgaaagcgtcggtc
ggtgcgccgccggatatcctcggtccgcttggccaaaactggggcctgccaccaatgagc
ccgcaggtgatgcggcaacggggctatcagccgttcatcgatctgatccagtcgaatatg
aaagcctgcggtgcactgcgtatcgatcatgtcatgggattgttgcgtctgtggtgggta
ccgcagggctccaccgccgtggaaggtgcgtttgtcagttatccggtggatgatctgctg
gcgattctggcactggagagccagcgtcatcagtgcatggtgatcggtgaggatttgggt
accgtcccggatgagattgtggccaagctgcgcgataatggcgtttattcctacaaggtc
ttttactttgaacgcgcgccagctccggacagcggcttctactcgccgcgcgattatccg
gcacaggcgatgaccaccctttccacgcatgatatgccgacgctgtacggctactggcag
gcggatgacctgacgctgggacaaaaactgggtttgtatccggatgccgaagtgctgtcc
ggcctttacgccgatcgggaacaggccaaacaacgcatgctcgacagtctgcacagcttg
cacagtctgccggaagaatacagccgtcaggcacagggcatgatgatgaacccggcgctg
aaccgcggcattcactgccatgtcgcgcaaagcaacagtgccctgctcggcctgcagccg
gaagactggctgaatatgaccatgccggtcaacattcccggtaccacacatgagatttac
cccaactggcgccgcaagttgagctgcacgttggaagccatgtttaacgattcagatgtc
atctcgctgctggctgaaataaaccggcgccgccgacagctatacccaaacaacttggag
ttgcaggtaggcggcaagtga

DBGET integrated database retrieval system