KEGG   Tolumonas auensis: Tola_0060Help
Entry
Tola_0060         CDS       T00904                                 

Definition
exodeoxyribonuclease V subunit alpha (EC:3.1.11.5)
Orthology
K03581  
exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
tau  Tolumonas auensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tola_0060
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Tola_0060
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
80819..82717
Genome map
AA seq 632 aa AA seqDB search
MTFTFPALTPCWQALLEARLLRDLDVQLAQLLARWDADESVQLAVALTSQELGRGHVCFD
LSTWPERLAQWQAQLSQAALSWPETTVAALDAKLQQSPLVRVITDPSDAEEQGQPLTLFA
GRLYLSRYFRFEQQVACWLQQASLPADNAVNATELAAQLRQLFTPQPETDWQAVAVATAC
EGRFTLISGGPGTGKTTTVTKLLALLVAQSEQSLLIRLAAPTGKAAARLTESIAKAKTEL
ATQVNADWLEGIPTQASTLHRLLGVIPGQPEFRHHAQNPLPLDVLVVDEASMIDLPMMAR
LLAALPPQARLILLGDKDQLASVEAGAVLGDICRFVAQGISQPQAECLQQRTGYDLQPYV
QVTGHPLCDRLCLLRKSWRFAADSGIGKLAEAVNNGDEKTAQAVWTRDYRDIRLHSDEQR
LEMAVKLAAEGYHAYLALLDKPMSAEGAVALLQAFNQIRLLCALHDGPWGINGMNQAIGQ
RLQTQGRLQMTADWFAGRPVMITENDYGLGLYNGDIGIAASDGERLRVWFVLPDGKAHGF
LPSRLPAHDTAWAMTVHKSQGSEFTHTLLLLPPETNPLLTRELLYTGITRAREQLDLFAT
PEVLALMVRKQTERYSGLVTMLETMRALHDAE
NT seq 1899 nt NT seq  +upstreamnt  +downstreamnt
atgacattcacttttcctgcgttaaccccttgctggcaggcattactggaagcccgtctg
ctgcgtgatctggatgtccagctagcgcaactgctggctcgctgggatgctgacgaaagc
gtgcagctggcggtggcactgaccagtcaggaactcgggcgcgggcatgtctgctttgat
ctcagtacctggccggagcggctggcgcagtggcaggcccagctatcgcaggcagcatta
agctggcctgagaccaccgtggcagcgctggatgcaaagctacagcagagcccgctggta
cgggtcatcactgatccttcggatgctgaggaacagggccagccgttgacgctgtttgcc
ggccggctctacctcagccgttactttcgttttgaacagcaggtggcgtgctggctgcag
caagccagtctgccagcggacaacgccgtgaatgcaaccgaactggccgcgcagttacgg
cagttgtttacaccgcagccggaaaccgactggcaggcggtggccgtcgccacggcttgt
gaggggcgctttaccctgatctccggcggccccggcactgggaaaaccacgacagtgacc
aaactgctggcgttgctggtggcgcagagtgagcaatcattgctgatccggctggcggca
ccgaccggaaaggcggctgcccggctgacggaatcgatcgccaaagccaaaaccgaactg
gcaacacaggtgaatgccgactggctggaaggtattccgacgcaggccagtaccctgcat
cgtctgctgggggtgatccccggtcagccggagttccgccaccatgcgcagaatccgttg
ccactggatgtgctggtggtcgatgaagcctcgatgatcgatctgccgatgatggcacgt
ctgctggccgcgttaccgccgcaggcgcggctgatcctgctgggagataaagaccagctg
gcgtcggtcgaagcgggtgcggtgctgggcgatatctgccggtttgtggcgcagggcatc
agtcagccacaggcggaatgcctgcagcaacgcaccggctatgatttgcagccgtatgtg
caggtcaccgggcatccgctgtgcgatcggctttgtctgctacggaaaagctggcgtttt
gctgcggactccggcatcggtaaactggccgaagcggtgaataatggcgatgaaaaaacg
gcacaagcggtatggacgcgggattaccgcgatatccgtctgcacagcgatgaacagcgg
ctggaaatggcagtgaagctggccgctgagggatatcatgcctatctggcattgctggat
aaaccgatgagcgccgaaggcgcggtcgcgctgttacaggctttcaaccagatccgcctg
ctgtgcgccctgcatgacgggccgtggggcatcaatggcatgaatcaggcgattggtcag
cgcctgcagactcagggcagactgcagatgacggcggactggtttgccggtcgcccggtg
atgatcaccgagaatgattatggtctggggctgtataatggcgatatcggcattgctgcc
agcgacggtgaacggttgcgggtctggtttgtgctgccggatggaaaggcgcatggtttt
ctgcccagtcgcctgccggcgcacgataccgcctgggcgatgaccgtacataaatcgcag
ggttcggaatttacccacacgctgctgctgttaccgccggagacgaacccgttgctgacc
cgcgagttgctctataccggcatcacccgggcacgtgaacagctggatctgtttgccacg
ccggaagtgctggcattgatggtgcgcaaacagaccgaacgctacagcggcttagtgacc
atgctggaaacaatgcgtgcgttgcatgacgcagaataa

DBGET integrated database retrieval system