KEGG   Tolumonas auensis: Tola_0068Help
Entry
Tola_0068         CDS       T00904                                 

Definition
glycerol kinase
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tau  Tolumonas auensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tola_0068
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tola_0068
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tola_0068
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(91663..93156)
Genome map
AA seq 497 aa AA seqDB search
MTKQRYVVALDQGTTSSRAIIFDHDARIVAVSQREFTQHYPQPGWVEHDPMEIWATQSST
LTEALAKSGIHNDEIAAIGITNQRETTVVWEKATGKPVYNAIVWQCRRTAAICEELKARG
LDNYVRENTGLLLDAYFSGTKVKWILDNVEGAREKAERGELLFGTIDTWLIWKMTNGEVH
VTDPTNASRTMLYNIRDLQWDGHILQELGIPASMLPQVRPSSEVYGYTTRGGGAQIPISG
IAGDQQAALFGQLCFEKGMAKNTYGTGCFLLMNTGETPVKSESGLLTTIAVGPTGNVNYA
LEGSVFMGGATVQWLRDELRLIDDATDTGYFAGKVKDSNGVYLVPAFVGLGAPYWDPYAR
GAIVGLTRGANRNHIIRAALESIAYQSRDVLDAMQKDSGIRLASLKVDGGAVANDFLMQF
QSDIMGTTVVRPKLIETTALGAAFLAGLAVGFWESTAELSDKFSIDREFEPALPAEQREQ
LYSGWQKAVTRSQHWVD
NT seq 1494 nt NT seq  +upstreamnt  +downstreamnt
atgacaaaacaacgttacgtcgtcgcactcgaccagggtactacctcttcccgcgccatt
atcttcgaccatgatgcgcgtattgtggcggtatctcagcgtgaattcacccagcactat
ccgcaaccgggctgggtagaacatgacccgatggaaatctgggcaacacagtcctccacg
ctgacagaggcactggcaaaatccggtatccataacgacgaaattgccgcgattggtatc
accaaccagcgtgaaaccacggtggtatgggaaaaagcgaccgggaaacccgtgtataac
gccatcgtctggcagtgccgccgtaccgccgctatttgtgaagagctgaaagcgcgtggt
ctcgataactacgtgcgtgaaaataccggtctgctgctggatgcttacttctccggtacc
aaggtgaaatggatcctcgataacgtcgaaggggcgcgtgaaaaagcggaacggggtgaa
ctgctatttggcacaattgatacctggctgatctggaaaatgaccaatggtgaagtgcac
gtcaccgatccgaccaatgcgtcgcgcaccatgctgtataacatccgcgatctgcagtgg
gacggtcatattctgcaggaactgggcattccggcctcgatgctgccgcaggttcgtcca
tcttctgaggtctatggctacaccacccgtggcggcggtgcgcagatcccgatctccggt
attgccggcgatcagcaggcggcgttgttcggccagctctgctttgaaaaaggcatggca
aagaacacttacggtaccggctgcttcctgctgatgaataccggtgaaacgccggtgaaa
tcagaaagtggtttgctgaccaccatcgccgtgggcccaaccgggaatgtgaactatgcg
ctggaaggctcggtgtttatgggtggcgcgacggtgcaatggctgcgcgatgagctgcgg
ctgatcgatgatgccaccgataccggttattttgccggcaaggtaaaagactctaacggt
gtctatctggtgccggcctttgtcggactcggcgctccctactgggacccgtatgcccgg
ggcgcaatcgtcggcctgacgcgtggcgctaaccgcaatcacatcatccgtgccgcactg
gaatcgatcgcctatcaaagccgtgatgtgctggatgcgatgcagaaagactccggtatc
cggctcgccagtctgaaagtcgatggtggtgcggtggcgaatgacttcctgatgcagttc
cagtccgacatcatgggtaccaccgtggtgcgtccgaaactgattgaaaccaccgcactg
ggtgccgccttcctcgccggactcgcggtcggcttctgggagagcaccgccgagctgagc
gataaattcagcatcgatcgcgagttcgaaccggcactgccggcagaacagcgcgaacag
ctgtatagcggctggcagaaagcggtcacgcgctcacagcactgggtggattag

DBGET integrated database retrieval system