KEGG   Tolumonas auensis: Tola_0136Help
Entry
Tola_0136         CDS       T00904                                 

Definition
3-deoxy-D-manno-octulosonic-acid transferase
Orthology
K02527  
3-deoxy-D-manno-octulosonic-acid transferase [EC:2.4.99.12 2.4.99.13 2.4.99.14 2.4.99.15]
Organism
tau  Tolumonas auensis
Pathway
Lipopolysaccharide biosynthesis
Metabolic pathways
Module
Lipopolysaccharide biosynthesis, KDO2-lipid A
Class
Metabolism; Glycan biosynthesis and metabolism; Lipopolysaccharide biosynthesis [PATH:tau00540]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(145557..146864)
Genome map
AA seq 435 aa AA seqDB search
MIGFSDTVAQTLCRSLSMRLLYTFLIYLLLPVILFLLYRPQRGKPGFGSRWKEHFGFVTA
PNARFPLWIHAVSVGETIAVTPLIKALKQQHPDLPILLTTTTRTGADQAARLGDLVEHRY
APLDYPGAVARFLQQIKPRALLIMETELWPNLLASCGHRKIPVVILNARLSERSCQRYQH
IRHFFQQMSHSLTLLLCQHHEDAARFKRLGVAEQQIAVTGSIKFDIQLDQKQIEAGEQYR
QELNHRPVWIAASTHKGEDELILRAHRQILQQIPDTLLLLVPRHPERFTDVAQLCQNQGF
TLCRRSEQRTATSDENILLGDSMGEMAYYFQIADLAFMGGSLVPVGGHNLLEPAALAKPT
LIGPHFFNFNDITRQLVEKKACYIIQNDDELARNVITLLRSEEQRLEMGMVGFDVVAANQ
GAIAKSLAAISKIVQ
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgatcggtttttctgatactgtcgcccaaactctctgccggtcgctctctatgcgttta
ctttatacttttctcatttatttgttgctgccggtaatcttatttctgctttatcgccct
caacgaggcaaaccgggttttggctcccgctggaaagaacactttggcttcgtaaccgca
ccaaatgcccgctttccgctctggatccacgcggtcagcgttggtgaaacgattgcggta
acgcctctaatcaaagcgttaaaacaacaacatccggatttgccaatcctgctaaccacc
accacccgtaccggtgccgatcaggcggcacgactgggagatctggttgaacatcgatac
gcaccgctggattatcccggtgccgttgcccgttttctgcaacagatcaagccccgggcg
ttgctcatcatggaaacagaattatggccaaacttattagccagctgtggccaccggaaa
ataccggtcgtgatcctgaatgcgcgcttgtccgaacgttcctgccagcgttatcagcat
atacgccatttctttcagcaaatgagccattcgctaacgttgctcctgtgtcagcatcat
gaggatgccgcacgctttaaacgcttaggcgttgccgaacagcaaattgccgtcacaggt
tcgattaaatttgatatccagttggatcaaaagcaaattgaagccggtgagcaatatcgt
caggaattaaatcatcgtccggtctggatcgcagccagtacccacaaaggtgaagacgaa
ttgatcctccgggcgcatcggcagatcctgcagcagataccagacactttgctgcttctg
gttccccgtcatccggagcgattcactgatgtggctcagctttgccagaatcagggcttc
acactctgtcgtcgcagtgaacaacgcacggccacgtcagatgaaaatatattgctgggc
gacagcatgggcgaaatggcttattacttccagatcgccgatctggcctttatggggggc
agcctcgttccggttggcgggcataatttgctggaaccggcagcgctggccaaaccaaca
ctgatcggtcctcatttctttaatttcaatgatataaccagacaactcgtagagaaaaaa
gcctgttacatcattcagaatgacgatgagctggcaagaaacgtgatcacattactccgc
tcagaggagcaacggttggagatgggtatggttggatttgatgtggttgccgctaatcag
ggcgcaatagccaagagtctcgcggcaataagcaaaatcgtgcaataa

DBGET integrated database retrieval system