KEGG   Tolumonas auensis: Tola_0180Help
Entry
Tola_0180         CDS       T00904                                 

Definition
(GenBank) guanylate kinase
  KO
K00942  guanylate kinase [EC:2.7.4.8]
Organism
tau  Tolumonas auensis
Pathway
tau00230  Purine metabolism
tau01100  Metabolic pathways
Module
tau_M00050  Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tola_0180
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     Tola_0180
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Guanylate_kin AAA_33 AAA_16 ABC_tran RsgA_GTPase AAA_19 AAA_35 cobW AAA_30 Lipocalin_5 AAA_29 AAA_23
Motif
Other DBs
NCBI-ProteinID: ACQ91810
JGI: Tola_0180
UniProt: C4L811
Position
complement(196061..196690)
Genome map
AA seq 209 aa AA seqDB search
MAAAGTLFIISSPSGAGKSSLLTALLSRYNSDGRMALSVSHTTRAMRPGEENGVHYHFVS
KEEFQALIARDAFFEWAEVFGNYYGTSKELIEQALAKGIDVFLDIDWQGARQIRELYSAT
QSIFVLPPSLPILEQRLIGRGQDSTEVIAKRMAQAVSEMSHYPEYDYLIINDDFEQALQQ
LHAIVLAGRAKLRPQAICHAELLNQLLAG
NT seq 630 nt NT seq  +upstreamnt  +downstreamnt
atggctgctgcaggtacgctatttattatttcctctcccagcggagcaggaaaatccagt
ctgttaacagcgttattgtcacgctataacagcgatggccggatggcactttccgtttct
cataccacgcgggcgatgcgccccggtgaagaaaatggtgtgcattaccactttgtcagc
aaagaagagtttcaggctttgattgcccgcgatgctttttttgaatgggcagaggtattt
ggtaattattacggcacatccaaagaattgatagaacaggcgctggctaaaggtattgat
gtattccttgatatcgactggcagggcgcacgtcagatccgcgaactgtatagcgcaacc
caatctatttttgtattgccgccaagtttgccaatcctggaacaacgactgattggccgc
ggtcaggacagcactgaagtgattgccaagcgcatggcgcaggcggtttcagaaatgtcg
cactatcctgaatatgactatctgatcatcaatgatgattttgaacaggcattgcaacaa
ttgcatgccatcgtactcgcgggtcgcgcaaaactgcgtccgcaggctatttgtcacgcc
gaactgctgaatcagctactggcgggataa

DBGET integrated database retrieval system