KEGG   Tolumonas auensis: Tola_0330Help
Entry
Tola_0330         CDS       T00904                                 

Definition
(GenBank) Porphobilinogen synthase
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
tau  Tolumonas auensis
Pathway
tau00860  Porphyrin and chlorophyll metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
Module
tau_M00121  Heme biosynthesis, glutamate => heme
tau_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tola_0330
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     Tola_0330
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tola_0330
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-ProteinID: ACQ91960
JGI: Tola_0330
UniProt: C4L961
Position
complement(371800..372810)
Genome map
AA seq 336 aa AA seqDB search
MPQFVSSPFPLRRLRRVRKHEFSRRLVRENQLSVDDLIYPMFVLDGESRRETITSMPGIE
RLSLDLLLQEAEELVRLGIPAIALFPVIPAEQKSLLAEEAYNDDGLVPCVVRALKERFPE
LGVITDVALDPYTTHGQDGIIDDHGYVLNDITSDILVRQALCHAKAGADIVAPSDMMDGR
IAAIRRSLEQHNLVNTQIMAYSAKYASNYYGPFRDAVGSSANLGKGNKNTYQMDPANSNE
ALQEVGLDIQEGADMVMVKPGMPYLDIIHRVKHQYGVPTFAYQVSGEYAMHMAAIQNGWL
KERECIMESLLCFKRAGADGILTYFAKQVAYWLQNK
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgccgcaatttgtatcctcaccatttccgcttcgccgtttgcgcagagtccgtaaacat
gaattcagccgccgtctggtacgtgagaatcagctgagtgttgatgatctgatttatccg
atgtttgttttagatggcgagagtcgtcgtgaaacgattaccagcatgccgggaattgaa
cgcttatcactggatctgttattacaggaagctgaagagttggtacggttaggtatccca
gccatcgccctgtttccggttatacccgcagaacaaaaaagtttgctggcagaggaagcc
tataacgatgacggactggtcccctgtgttgtgcgcgcactaaaagaacgctttccagag
ttaggcgtaatcaccgatgtggcacttgatccttatacgactcacggacaggatggcatc
attgacgatcatgggtatgtactgaatgacattaccagcgatattcttgtccggcaggcg
ctttgtcatgcgaaagccggagcagatatcgttgcgccatccgacatgatggatggccgt
attgctgcaatcagacgctcactcgaacaacataatctggtcaacacacagatcatggcc
tactccgctaaatatgcatccaattactacggaccattccgggatgctgtcggctcttcg
gctaatcttggtaaaggtaataaaaatacctatcagatggatccggctaacagcaatgaa
gccctacaggaagttggtctggatatacaggaaggtgccgatatggtgatggtgaaacca
ggtatgccttatctcgatatcattcaccgggtcaaacatcaatatggtgtaccaaccttt
gcctaccaggttagtggggaatatgccatgcatatggcagctatccaaaatggctggtta
aaagaacgcgagtgcatcatggagtccctgctttgctttaaacgggccggagcagatggc
attctgacttattttgctaaacaggttgcttactggttacagaataagtaa

DBGET integrated database retrieval system