KEGG   Tolumonas auensis: Tola_0407Help
Entry
Tola_0407         CDS       T00904                                 

Definition
6-phosphofructokinase
Orthology
K16370  
6-phosphofructokinase 2 [EC:2.7.1.11]
Organism
tau  Tolumonas auensis
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tola_0407
   01230 Biosynthesis of amino acids
    Tola_0407
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_0407
   00030 Pentose phosphate pathway
    Tola_0407
   00051 Fructose and mannose metabolism
    Tola_0407
   00052 Galactose metabolism
    Tola_0407
  Energy metabolism
   00680 Methane metabolism
    Tola_0407
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     Tola_0407
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(459267..460199)
Genome map
AA seq 310 aa AA seqDB search
MPLIVTLTLTPSLDTATSTAKVYPEGKLRCQAPVFEPGGGGINVARAITHLGGQATALLP
SGGPTGAHLVELLQQEGVTVDALQTHDWTRQNLHVVSDATGEQFRFVMPGAALHEDEWQQ
LLTKIAQLPAGTLLVLSGSLPPNMTTSAVTELLQCARQQGLRTIVDSSGDALKAAVAFGG
LELLKPNQSELAELTGQSLEQPDQVVNAARSLISQGAAKRIVVSLGPQGALAVDAEQCIQ
VVPPPVIKRSTVGAGDSMVGAMVLKLAEDAPLADMVRFGVAAGTAATMNQGTKLCSKDDT
EKLYQYLQQQ
NT seq 933 nt NT seq  +upstreamnt  +downstreamnt
atgcctctgattgtgactctcacactgaccccgtcactggacaccgccaccagcacagcc
aaagtctacccggaaggaaaattgcgctgccaggcaccggtgtttgaacccggtggtggc
ggcatcaacgtcgcccgtgccatcacacacctcggcggacaagccacagccctgctcccc
tccggtggcccaaccggtgcccatctggttgaactgctgcagcaggaaggcgttaccgtg
gatgcactgcagacccatgactggacccggcagaacctgcatgtggtctccgacgccacc
ggtgaacagttccgctttgtgatgccgggtgcggcattgcatgaagatgaatggcagcaa
ttgctgacgaaaatagcccaattaccggccggaacgttactggtgttgagcggcagtttg
ccgccgaatatgacgacatccgccgtgacggaactgctgcagtgtgcccggcaacagggg
ctgcggacgatcgttgacagctccggtgacgccttaaaagcggcggtcgcttttggtggt
ctggaactgttaaaacccaatcagtccgaactggcagaactgaccggtcagtcgctggaa
cagcctgatcaggtggtgaatgcggcccgttcgctgattagtcagggggcggcaaaacgc
attgtcgtctcgctgggtccgcagggtgcgctggctgtggatgcggaacaatgcatccag
gtagtgccaccgccggtgattaaacgcagcacggtcggtgccggtgacagtatggtcggc
gccatggtgctgaaactggcagaagatgcgccactggcggatatggtgcgctttggcgtt
gccgccggtacggctgcgaccatgaatcagggcaccaaactgtgcagcaaagatgatacc
gaaaaactgtatcagtatctgcaacagcaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system