KEGG   Tolumonas auensis: Tola_0450Help
Entry
Tola_0450         CDS       T00904                                 

Definition
Beta-glucosidase (EC:3.2.1.21)
Orthology
K01223  
6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tau  Tolumonas auensis
Pathway
Glycolysis / Gluconeogenesis
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:tau00010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(505159..506541)
Genome map
AA seq 460 aa AA seqDB search
MMQYRFPENFWWGSASSGPQSEGATLRDGKSATIWDKWFDESPNRFFNQVGPQDTSTFYD
HFRSDIQLMKQLNHNTFRTSIAWARLIPNGTGEVNPLAVRFYNDMLDELLANGIEPFINL
FHFDMPLCMQEKGGWESREVVDAYADFAETCFRLFGGKVKFWFTFNEPIVPVEGGYLYDF
HYPNVVDFRRAATVAYHTMLAHAKAVQRYRALQQEGQIGIVLNLTPSYPRSQHPSDLQAS
KIADLFFNRSFLDPAVKGEYPAELVELLKQYDQLPHCEAGDAELLAQGKVDLLGVNYYQP
RRVKARANAVNPASPFMPEWFFDYYEMPGRKMNPHRGWEIYEKGIYDILINLRDNYGNIP
SYISENGMGVEGEEKFLVEGQIQDDYRIKFVSDHLQWLHKGISENCACKGYHLWTFIDNW
SWSNAYKNRYGFVQLDLATQKRTIKKSGEWFADVSRNNGF
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgatgcagtatcgttttccggaaaatttctggtggggcagcgcctcctctggcccgcaa
tctgaaggtgccaccctgcgggatggcaagtcagccaccatctgggacaagtggtttgac
gaatcgcctaatcgctttttcaatcaggttggcccgcaggatacctccacgttttacgat
cacttccgcagtgatatccaactgatgaaacagctgaatcacaataccttccgcacctcc
attgcctgggcgcgcctgatcccgaacggtaccggagaggtaaatccgttagcagtcaga
ttttataacgacatgctggatgagctgctggccaatggcatcgagccattcatcaacctg
ttccacttcgatatgccactgtgcatgcaggaaaaaggcggctgggaaagtcgtgaagtg
gtcgatgcttacgccgattttgcggaaacctgcttccgtctgtttggtggcaaagtgaaa
ttctggttcaccttcaatgaaccgattgtgccggtggaaggcggctatctgtacgacttc
cattacccgaacgtggttgatttccgccgcgccgcgactgtggcctatcacactatgctg
gcacatgccaaagcagtgcaacgctaccgtgcattgcagcaggaaggccagatcggcatt
gtgctgaacctgaccccctcttacccgcgctcacaacatccgtcagatctgcaggcatca
aaaattgccgatctgttctttaaccgcagtttcctcgacccggcggtaaaaggcgaatat
ccggctgaactggtggaattgctcaagcaatacgatcagttgccgcactgcgaagccggc
gatgccgagctgctggcacagggaaaagttgatttactgggcgtgaattactaccagcca
cgccgcgtgaaagcccgcgccaatgcagtgaatccggccagtccgttcatgccggaatgg
ttctttgattattacgaaatgccgggccgcaagatgaacccacaccgtggctgggagatc
tacgaaaaaggcatctacgacattctgatcaatctgcgggacaactacggcaacattcct
tcttacatttctgagaacggcatgggtgtcgaaggcgaagaaaaatttctggtggaaggt
cagatccaggatgactaccgcatcaagtttgttagtgatcatctgcaatggctgcataaa
ggcatcagtgaaaattgcgcctgtaagggttatcacctgtggaccttcatcgataactgg
tcatggagcaacgcctataaaaaccgttatggctttgtacagctcgatctggccacccaa
aaacgcacgattaaaaagagtggcgaatggttcgccgatgtctcccgcaataatggtttt
taa

DBGET integrated database retrieval system