KEGG   Tolumonas auensis: Tola_0520Help
Entry
Tola_0520         CDS       T00904                                 

Definition
UDP-N-acetylmuramyl tripeptide synthetase
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
tau  Tolumonas auensis
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    Tola_0520
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Tola_0520
Enzymes [BR:tau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     Tola_0520
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
586391..587860
Genome map
AA seq 489 aa AA seqDB search
MPLALKQLMAGLNIQAPEIALCDMQLDTRLLQPGSLFLALKGHATDGRMFMQQAEQKGAA
AILFDNSDGFVPSELSIPCIPVPALAEKVSELAGLFYDSPAQKLDLVGVTGTNGKSTCTQ
LIANWTELFGQRGGVLGTLGNGLFGQLHATENTTGSAISIQQELARFVAEKVDVAAMEVS
SHGLVQHRVSALQFAAAVFTNLSRDHLDYHHTMQAYAEAKRLIFKQTTPECCILNADDAT
AREWLLQMPQAVVYGIDQQLPEHPGPFVYATDVKYHPQGITISIHSSWGDGVLSAPLLGK
FNVSNLLAALAVMLVLQYDFETLCQTASRLQPVTGRMECFGNQDQPLVVVDYAHTPDGLE
KALQAARQHCHGHLFCLFGCGGDRDRGKRPQMAAIAEQWADTLILTDDNPRTEDPAAIIA
DMCAGLQKPEQAHIEHSRPKAIQLALAQAVPGDIILLAGKGHEDYQIIGKEKHHYSDRET
VMQLLGVMQ
NT seq 1470 nt NT seq  +upstreamnt  +downstreamnt
gtgccactcgctcttaagcaactgatggcgggtctgaatattcaggcacctgagattgca
ctgtgtgatatgcagttagatacccggctattacagccgggctcattgtttctggcgctg
aaaggccatgcaaccgatggccgtatgtttatgcagcaggcggaacaaaaaggcgcagct
gcaatattgtttgataacagcgacggttttgtaccatcggaactgagtattccctgtatc
cctgtgccggcgctggcggaaaaggtcagtgaactggccggactgttctatgactctccg
gcacaaaagctggatctggtcggggttaccggtacaaatggcaaaagtacctgtacccag
ctgattgctaactggacagaattattcgggcagcgtggtggtgtactggggacgctgggc
aatggtttgtttggtcaattgcatgcaacagaaaacaccacgggcagtgcgatctccatt
cagcaggagttagcccggtttgttgctgaaaaagttgatgttgccgcgatggaagtctct
tctcatggtctggttcagcaccgtgtgtcggcgctgcagtttgctgcggcagtatttacc
aatctgagccgcgatcatctcgattatcatcacaccatgcaggcatatgctgaagctaag
cgcctgatatttaaacagacaaccccagaatgctgcattctgaacgctgatgatgctact
gcacgtgaatggttgctgcagatgccgcaagctgtggtgtatggcattgatcagcaactg
ccggaacatccgggaccatttgtttacgcgaccgatgtaaaatatcacccgcagggtatt
actatcagcattcactcttcatggggggatggtgtattatctgcgccccttctcgggaag
tttaatgtatctaatttgctggcggcgttagcggtaatgttggttttgcagtacgacttt
gaaacgctgtgtcagacggcttcgcgcctgcagccagttactggtcgcatggagtgtttt
gggaatcaggatcagccactggttgtggttgattatgcgcatacgccagatggtctggaa
aaagccttacaggcagccagacagcattgtcatggtcatctgttctgcctgtttggctgt
ggcggagaccgtgatcggggcaaacgacctcaaatggcggcaatagctgaacaatgggca
gataccctgatcctgactgatgataatcctcgtactgaagatcctgcagccattattgca
gatatgtgtgccggtttgcagaaaccggaacaggcacatatcgaacattcgcgaccaaaa
gctattcagctggcactggctcaggctgttcccggtgacattattcttctggccggaaaa
ggccatgaggattaccagatcattggaaaagaaaaacaccattacagtgatcgcgaaaca
gtcatgcaactactgggagtaatgcagtga

DBGET integrated database retrieval system