KEGG   Tolumonas auensis: Tola_0552Help
Entry
Tola_0552         CDS       T00904                                 

Definition
(GenBank) DNA polymerase III chi subunit HolC
  KO
K02339  DNA polymerase III subunit chi [EC:2.7.7.7]
Organism
tau  Tolumonas auensis
Pathway
tau00230  Purine metabolism
tau00240  Pyrimidine metabolism
tau01100  Metabolic pathways
tau03030  DNA replication
tau03430  Mismatch repair
tau03440  Homologous recombination
Module
tau_M00260  DNA polymerase III complex, bacteria
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    Tola_0552
   00240 Pyrimidine metabolism
    Tola_0552
 Genetic Information Processing
  Replication and repair
   03030 DNA replication
    Tola_0552
   03430 Mismatch repair
    Tola_0552
   03440 Homologous recombination
    Tola_0552
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     Tola_0552
DNA replication proteins [BR:tau03032]
 Prokaryotic Type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     Tola_0552
DNA repair and recombination proteins [BR:tau03400]
 Prokaryotic Type
  SSBR (single strand breaks repair)
   MMR (mismatch exicision repair)
    DNA polymerase III holoenzyme
     Tola_0552
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DNA_pol3_chi
Motif
Other DBs
NCBI-ProteinID: ACQ92181
JGI: Tola_0552
UniProt: C4LA52
Position
620552..621031
Genome map
AA seq 159 aa AA seqDB search
MTSLYFMPQVTFYLLPDEASPTQICDGLSHVVAVLACQLTTERFRQNQTLFLLTQTQVQA
EQLDEMLWQQDPHSFVPHGLSDEATVTQAPVEIGTGMPKRSRQVLINLADGIPAFAGRFA
QIIDFVPADEIQKQQARERYKQYRALGFTLETVPAPQLP
NT seq 480 nt NT seq  +upstreamnt  +downstreamnt
gtgacgtccctttacttcatgccacaggtcactttttatttactgccggatgaggcatcg
ccgacacagatttgtgatggcttaagccatgtcgtcgctgtgttagcctgccagctgacg
acagaacgtttccgccagaatcagacgctgtttttgctgacgcagacacaagtgcaggcg
gagcagctagacgaaatgttgtggcagcaggatccgcatagttttgtgccacacggcctg
tcagacgaagcgacagtgactcaggctcctgtcgagatcggtaccggtatgcctaaacgc
agccggcaggtgctgatcaatttagctgacgggatcccggcttttgccggacgttttgct
cagatcattgatttcgtccctgctgacgaaattcaaaaacaacaggcgcgcgaacgctac
aagcagtatcgggcgctgggtttcacgctggagacggtgcctgcaccgcaactcccataa

DBGET integrated database retrieval system