KEGG   Tolumonas auensis: Tola_0575Help
Entry
Tola_0575         CDS       T00904                                 

Definition
ribokinase
Orthology
K00852  
ribokinase [EC:2.7.1.15]
Organism
tau  Tolumonas auensis
Pathway
Pentose phosphate pathway
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00030 Pentose phosphate pathway
    Tola_0575
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.15  ribokinase
     Tola_0575
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
644641..645564
Genome map
AA seq 307 aa AA seqDB search
MSKKLVVLGSVNADHVLSVPRFPKPGETLVGSGYHIAYGGKGANQAVAAGRTGADIAFIA
CVGSDDIGARMREQFAADGIDTQAVMAIEGTTTGVAMIWVSADGENCIGISAGANAELTP
ARLQPHLPLIADADVLLMQLESPLSTVEAAAQTARIAGTKVILNPAPAQALPESLLRLVD
VITPNETEAQALTGVVVDTEQDAQKAADVLHTYGISTVLITLGARGVWVSEQGKGELIPG
FRVQALDTTAAGDTFNGALVTAELEGLPLRQAIRFAHAAAAISVTRSGAQPSIPVRSEVD
AFLAARS
NT seq 924 nt NT seq  +upstreamnt  +downstreamnt
atgagcaaaaaactggtcgttctcggcagcgtgaatgccgaccacgtattatctgtaccc
cgctttccgaaaccaggtgaaacgctggtcggaagcggttatcacattgcttatggcggc
aagggggcgaatcaggccgtcgcggctggccgtactggcgccgatattgctttcattgcc
tgtgtgggcagtgatgatatcggtgcccgcatgcgggagcagtttgcggcagacggtatt
gatactcaggcggtgatggcgatagaaggcaccaccaccggcgttgccatgatctgggtt
tccgcggatggagaaaactgcatcggtatttctgccggtgccaatgcagaactaacgccc
gcccgcctgcaaccgcatctgccattgatcgctgatgcggatgtgttgctgatgcagctg
gaaagtccgctaagcacggtggaagcggccgcacagacggcaagaattgcgggaacaaaa
gtgatcctgaatccggctccggcccaggcattaccggaatcactgttacggctggtcgat
gtcatcacccccaatgaaacagaagcgcaggcgctgacgggcgtggtcgttgacaccgaa
caggacgcacaaaaagcggcggatgtcctgcatacctatggcataagtacggtgttaatt
acgttaggtgccagaggggtttgggtgagtgaacagggcaaaggtgaactgatccctggt
ttccgggtacaggcgctggataccacggcggcgggcgatacctttaacggcgctttggtc
acggcagagctggaagggttgccattacgccaggcgattcgttttgcgcatgcagctgcg
gcgatttccgtgacccgttccggcgcacaaccttcgattccggtaagatctgaggtggat
gcgtttctggcagcaaggagttag

DBGET integrated database retrieval system