KEGG   Tolumonas auensis: Tola_0623Help
Entry
Tola_0623         CDS       T00904                                 

Definition
threonine synthase (EC:4.2.3.1)
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
tau  Tolumonas auensis
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tola_0623
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tola_0623
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    Tola_0623
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     Tola_0623
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
703577..704851
Genome map
AA seq 424 aa AA seqDB search
MKLYNIKDHSEQVSFAQAVKQGLGRGQGLFFPEQIAPLADVDALLDKPLVARSVAILKHL
IGDELSQEQLQQMVGTAFSFPAPLAKVADNCYALELFHGPTLAFKDFGGRFMAQCLTAFS
TGEKITILTATSGDTGAAVAHAFYGLPNIEVVILYPEGKISPLQEKLFCTLGGNIRTIAI
KGTFDDCQAMVKNAFDDEELKKAIGLNSANSINISRLVAQVCYYFEAIAQLPKAQREQAV
IAVPSGNFGNLTAGLIAKALGLPVKRFIVATNANDTVPRYLAEGTWDPKETVPTLSNAMD
VSRPNNWPRVEELFKVKGWDLKELGYAARTDEETRASLKKLNAEGYLCEPHGVIAWDVLQ
SQLAADETGIFLCTAHPAKFKESVEDILQIELPLPKALADRADLPLLSTFMPADFAKLRE
YLMA
NT seq 1275 nt NT seq  +upstreamnt  +downstreamnt
atgaagctttacaacatcaaagatcattcagaacaggtcagctttgctcaggccgtgaaa
caggggctgggtcgcggtcagggtctgttcttcccggaacagatcgcaccgttagccgat
gtggatgcgctgctggacaagcctttggttgcgcgttcagttgccattctgaagcatttg
atcggtgatgaactgtcgcaggaacaattgcagcagatggttgggactgctttctctttc
ccggctccgctggcgaaagtagcggacaactgctatgcactggaactgttccatggtccg
acactggcattcaaggattttggcggccgtttcatggcgcaatgtctgactgcgttcagt
acgggcgagaagatcactatcctgacagccacttccggtgataccggtgccgctgtagcg
catgctttctatggtctgccaaatattgaagttgtgatcctctatccggaaggcaagatc
agcccgctgcaggaaaagctgttctgcacactgggtggtaatatccgtactatcgctatc
aaaggcacctttgatgattgtcaggcgatggtaaaaaatgcatttgatgatgaagagctg
aaaaaagcgattggtctgaattctgcaaactccattaatatcagccgtctggttgcgcag
gtctgctactactttgaagcgattgcccagttgccaaaagcacagcgtgaacaggcagtg
attgcagttccgtccggtaacttcggtaacctgaccgccggtctgatcgctaaagctctg
ggtttaccagtgaagcgttttattgttgcaaccaacgctaacgataccgtgccacgttat
ctggcagaaggtacctgggatcctaaagaaacagtgccaacgctgtcgaatgcgatggat
gtcagccgcccgaacaactggcctcgtgttgaagagctgttcaaggtaaaaggctgggat
ctgaaagagctgggttacgctgcacgtacggatgaagaaacccgtgccagtctgaagaaa
ctgaatgctgaaggctatctgtgcgaaccacacggtgttatcgcgtgggatgtattgcaa
tcgcagctggctgctgatgagacgggtattttcctgtgtaccgctcatccggcgaaattc
aaagaaagcgtggaagatattcttcagatcgaactgccgctgccaaaagcactggctgat
cgcgccgatcttccattgttgtcaaccttcatgccggcagatttcgccaagctgcgtgaa
tacctgatggcttaa

DBGET integrated database retrieval system