KEGG   Tolumonas auensis: Tola_0810Help
Entry
Tola_0810         CDS       T00904                                 

Definition
(GenBank) glutamate 5-kinase
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
tau  Tolumonas auensis
Pathway
tau00330  Arginine and proline metabolism
tau00332  Carbapenem biosynthesis
tau01100  Metabolic pathways
tau01130  Biosynthesis of antibiotics
tau01230  Biosynthesis of amino acids
Module
tau_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    Tola_0810
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    Tola_0810
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     Tola_0810
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA Glyco_transf_4
Motif
Other DBs
NCBI-ProteinID: ACQ92438
JGI: Tola_0810
UniProt: C4LBK3
Position
883832..884935
Genome map
AA seq 367 aa AA seqDB search
MKSKTIVVKLGTSILTGGTRKLDQAHMVELVRQCAALHRHGHQVVVVTSGAIAAGREKLG
YPDLPPTMPNKQMLAAVGQCHLMQVWQNLFSIYGLQIGQLLLTRADLEDRERYLNARDTL
QTLLHNRIIPVINENDAVAIAEIKVGDNDNLSARAAILADADLLILLTDQKGLFTADPRT
NPDATLIEEVTEITDQLRSLAGDSVSGLGTGGMSTKLQAADIACRAGIEVVIASGKTPEV
VGRLANNEKVGTRFKAQANPLEGRKSWILAGPQSHGEIHIDVGAVKAVHDKGSSLLPKGI
TKIAGEFGRGEAVRIITPEGKELARGITRYTADELERVRGHHSDEIESCLGYGYGPVAIH
RDDMVLL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaaaaccatcgtcgtcaagctgggcaccagcattcttaccggcggcacacgt
aaactggatcaggctcatatggttgaactggttcgtcagtgtgctgctctgcatcgtcat
gggcatcaggtcgtagttgtgacctccggcgcaattgctgccggtcgtgagaagttgggt
taccccgatcttccccccacaatgcccaacaaacagatgctggcggcggtgggacaatgt
cacctgatgcaggtatggcagaatctgttcagcatttacgggctgcagattggtcagtta
ttgctgacccgcgctgatctggaagatcgcgaacgttatctgaatgcgcgcgatacgctg
cagacattgctgcacaaccgtattatccctgttattaacgaaaacgacgccgttgcgatt
gccgaaatcaaagtcggtgataatgacaacctgtcagctcgcgctgcaattctggccgat
gcggatttattgatcctgctgaccgatcagaaagggctgtttactgctgatccgcgtact
aatcctgatgcaacattgatcgaggaagtgaccgaaatcaccgatcagctgcgtagtctg
gccggtgacagcgtgagtggcctcggcaccggtggtatgtctaccaaactgcaggcggcc
gatattgcctgccgtgcgggtattgaagtggttattgccagtggcaagacaccggaagtg
gtgggccgtctggctaataacgaaaaagtgggcacccgctttaaagcacaggccaacccg
ctggaaggacgcaagagctggatcctggccggtccgcagtcacacggtgaaattcacatt
gatgtcggtgccgtgaaagcggttcatgacaaaggttccagtctgttaccgaaaggtatc
actaagattgccggtgaattcggccgcggtgaagcggtgcgtattatcacaccggaaggt
aaagagctggcgcgtggtattacccgttatactgctgatgaattagaacgtgtacgcggt
catcattccgatgaaatcgaatcgtgtttaggttacggctatggtccggtggcaatccat
cgcgatgacatggtattgctgtaa

DBGET integrated database retrieval system