KEGG   Tolumonas auensis: Tola_0810Help
Entry
Tola_0810         CDS       T00904                                 

Definition
gamma-glutamyl kinase (EC:2.7.2.11)
Orthology
K00931  
glutamate 5-kinase [EC:2.7.2.11]
Organism
tau  Tolumonas auensis
Pathway
Arginine and proline metabolism
Metabolic pathways
Biosynthesis of amino acids
Module
Proline biosynthesis, glutamate => proline
Class
Metabolism; Overview; Biosynthesis of amino acids [PATH:tau01230]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:tau00330]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
883832..884935
Genome map
AA seq 367 aa AA seqDB search
MKSKTIVVKLGTSILTGGTRKLDQAHMVELVRQCAALHRHGHQVVVVTSGAIAAGREKLG
YPDLPPTMPNKQMLAAVGQCHLMQVWQNLFSIYGLQIGQLLLTRADLEDRERYLNARDTL
QTLLHNRIIPVINENDAVAIAEIKVGDNDNLSARAAILADADLLILLTDQKGLFTADPRT
NPDATLIEEVTEITDQLRSLAGDSVSGLGTGGMSTKLQAADIACRAGIEVVIASGKTPEV
VGRLANNEKVGTRFKAQANPLEGRKSWILAGPQSHGEIHIDVGAVKAVHDKGSSLLPKGI
TKIAGEFGRGEAVRIITPEGKELARGITRYTADELERVRGHHSDEIESCLGYGYGPVAIH
RDDMVLL
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgaaaagcaaaaccatcgtcgtcaagctgggcaccagcattcttaccggcggcacacgt
aaactggatcaggctcatatggttgaactggttcgtcagtgtgctgctctgcatcgtcat
gggcatcaggtcgtagttgtgacctccggcgcaattgctgccggtcgtgagaagttgggt
taccccgatcttccccccacaatgcccaacaaacagatgctggcggcggtgggacaatgt
cacctgatgcaggtatggcagaatctgttcagcatttacgggctgcagattggtcagtta
ttgctgacccgcgctgatctggaagatcgcgaacgttatctgaatgcgcgcgatacgctg
cagacattgctgcacaaccgtattatccctgttattaacgaaaacgacgccgttgcgatt
gccgaaatcaaagtcggtgataatgacaacctgtcagctcgcgctgcaattctggccgat
gcggatttattgatcctgctgaccgatcagaaagggctgtttactgctgatccgcgtact
aatcctgatgcaacattgatcgaggaagtgaccgaaatcaccgatcagctgcgtagtctg
gccggtgacagcgtgagtggcctcggcaccggtggtatgtctaccaaactgcaggcggcc
gatattgcctgccgtgcgggtattgaagtggttattgccagtggcaagacaccggaagtg
gtgggccgtctggctaataacgaaaaagtgggcacccgctttaaagcacaggccaacccg
ctggaaggacgcaagagctggatcctggccggtccgcagtcacacggtgaaattcacatt
gatgtcggtgccgtgaaagcggttcatgacaaaggttccagtctgttaccgaaaggtatc
actaagattgccggtgaattcggccgcggtgaagcggtgcgtattatcacaccggaaggt
aaagagctggcgcgtggtattacccgttatactgctgatgaattagaacgtgtacgcggt
catcattccgatgaaatcgaatcgtgtttaggttacggctatggtccggtggcaatccat
cgcgatgacatggtattgctgtaa

DBGET integrated database retrieval system