KEGG   Tolumonas auensis: Tola_0872Help
Entry
Tola_0872         CDS       T00904                                 

Definition
lysophospholipase (EC:3.1.1.5)
Orthology
K10804  
acyl-CoA thioesterase I [EC:3.1.2.- 3.1.1.5]
Organism
tau  Tolumonas auensis
Pathway
Biosynthesis of unsaturated fatty acids
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    Tola_0872
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.5  lysophospholipase
     Tola_0872
   3.1.2  Thioester hydrolases
    3.1.2.-  
     Tola_0872
Lipid biosynthesis proteins [BR:tau01004]
 Fatty acid synthase
  Component type
   Tola_0872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(952881..953480)
Genome map
AA seq 199 aa AA seqDB search
MLLSMCSLSGHASTLLILGDSLSAGYMMAAEQSWPVLLHQQWQKEKFPVTIINSSISGST
TQDGLARLPALLSRHKPDWVLIELGANDGIRGFPPAIPYETLKKSIQIIQKNGGQPLLMQ
IRIPRNYGAAYIAKLEAIYPKLAEETKTPLLPFFLESIVTQPKLMLNDGIHPTADAQPLI
RDMMEPLLRQYIETTEKTL
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
gtgttattatctatgtgttcactttctggccatgccagtacgctattgattctcggcgac
agcctgagtgccggctacatgatggcggcagaacaaagctggcctgttcttttgcatcag
caatggcagaaagaaaaattcccggtcactatcattaacagtagcatcagtggcagcacc
actcaggatggtttagcccgtctgcctgctttattgtcccgtcacaaacctgactgggtt
ttaattgaactgggtgccaatgatggtatccgcggttttccaccagctattccttatgaa
acgttaaagaaaagcattcagatcattcagaaaaatggcggacaaccactgttgatgcag
atccggatcccacgtaattacggtgccgcctatattgcaaaattggaagcgatttatccg
aagctggccgaggaaaccaaaacgcctttattgccgttttttcttgaatctatcgtgact
cagccgaaactgatgctgaacgatggtattcatcctacggctgatgcgcaaccactgatc
cgggatatgatggaaccattactgcgccaatacattgaaaccacagagaagactctttag

DBGET integrated database retrieval system