KEGG   Tolumonas auensis: Tola_0934Help
Entry
Tola_0934         CDS       T00904                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase (EC:2.7.7.9)
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
tau  Tolumonas auensis
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:tau00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tau00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tau00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:tau00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1016082..1016996)
Genome map
AA seq 304 aa AA seqDB search
MSTTQFAVRKAILPVAGLGTRMLPATKAIPKEMLPVVDRPLIEYVVREAIAAGIKEIVLV
THSSKNSIENHFDKSFELEATLEKRVKRQLLAEIQNICPKDVTIMHIRQGEAKGLGHAIL
CAHPLVGDNPFVVLLPDVLIDDASCDLKTDNLADMVKQFGETGVSQIMVEPVAKETVDQY
GIADVNGETLTPGISLPISQIVEKPAVDKAPSNLAVVGRYVLSADIWPLLEKTPLGAGDE
IQLTDAIAMLMEKQPVNAYMMKGKSHDCGSKLGYMKANVEYALRHKSLKNDFKAYLKELI
KTLD
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgagcaccacccaatttgcagttcgtaaagcgatattacctgtggcgggtctgggtacc
cgtatgttgccggcaaccaaagccattccaaaagaaatgctgcctgtggttgaccgtcca
ctgattgaatatgttgttcgtgaagcgattgctgccggcattaaagagatcgtgctggta
actcactccagtaaaaactctatcgaaaaccattttgataaaagttttgaattagaagcg
acactggaaaaacgcgttaagcgtcagttgctggctgaaattcagaacatctgtccaaaa
gatgtcaccatcatgcacattcgtcagggtgaagccaaaggcttgggccatgcaattttg
tgtgctcatccattggttggtgataatccgtttgttgtattgctgccagacgttctgatt
gatgatgcatcctgtgatctgaaaactgacaacctggctgatatggttaagcaatttggt
gaaacaggcgtcagccagatcatggttgagccggtagccaaagaaaccgttgatcagtat
ggtatcgctgacgtgaatggcgaaacactgactcccggcatttcactgccaatcagccaa
atcgtcgaaaaaccagcggttgataaagcgccttctaacttggcagtagtaggtcgttac
gtcctgtctgctgatatctggccgttactggaaaaaactccgctgggtgctggtgatgaa
attcagctgaccgatgctatcgccatgctgatggaaaaacagccggttaatgcatacatg
atgaaaggcaagagccatgattgcggtagcaaactgggctacatgaaagcgaatgtagaa
tatgctctgcgtcataagtcactgaaaaatgatttcaaagcctatctgaaagaattaatc
aaaactctcgattaa

DBGET integrated database retrieval system