KEGG   Tolumonas auensis: Tola_0936Help
Entry
Tola_0936         CDS       T00904                                 

Definition
3'(2'),5'-bisphosphate nucleotidase
Orthology
K01082  
3'(2'), 5'-bisphosphate nucleotidase [EC:3.1.3.7]
Organism
tau  Tolumonas auensis
Pathway
Sulfur metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    Tola_0936
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.7  3'(2'),5'-bisphosphate nucleotidase
     Tola_0936
Transfer RNA biogenesis [BR:tau03016]
 Eukaryotic Type
  tRNA degradation factors
   Rapid tRNA decay (RTD) pathway factors
    Tola_0936
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1017637..1018395
Genome map
AA seq 252 aa AA seqDB search
MLNDELIAAVLQIARDAGQSILSVYDEPVELTVKADESPLTQADKASHQLIEQKLRELTP
EWQVVSEESDDTVKAKRTVLPIYWLVDPLDGTKEFIKRNGEFTVNIALIVDGAAVFGVVG
VPVQNKLYWGGKGYGCWLQDETGSRALHVTTKPEQAMLRVVGSRSHVNAETAEYLQKLGE
HELVSVGSSLKFCLLAEGKADLYPRLGPTCEWDTAAAQAVLEGAGGKVETLEGQPLRYSK
PDILNPWFVASI
NT seq 759 nt NT seq  +upstreamnt  +downstreamnt
atgttgaatgatgaattaattgctgcggtattacagatagcaagagacgccgggcaatct
attttatctgtgtatgatgagccggttgaactcacggtgaaagctgacgagtcgccatta
acgcaagccgataaagcatcacatcagctgattgaacaaaaactccgggagctgacgccg
gagtggcaggtggtctccgaagaatcagatgacacagtcaaagccaaacgcacagtattg
ccaatctattggctggtggatccgctggatggcaccaaagagttcataaaacgtaatggt
gaatttaccgttaatattgcactgattgtggatggtgctgctgtgtttggtgtcgttggc
gtgccggtacagaataaactgtattggggcggtaaaggctatggttgttggcttcaggat
gaaacagggagccgcgccttacatgtgacaaccaaaccggaacaagcgatgttgcgtgtt
gttggcagccgttcacatgtaaatgctgaaactgcagaatatctgcaaaaactgggtgag
catgaattggtttctgtcggcagttcactgaagttttgtctgctggcggaaggcaaggcc
gatctttatccacgtttaggcccgacatgcgagtgggataccgctgctgcgcaggctgtt
ctggaaggggctggcggcaaagttgaaacgctggaagggcaaccattacgctatagtaaa
ccggatatcttaaatccgtggtttgttgcgtcgatttaa

DBGET integrated database retrieval system