KEGG   Tolumonas auensis: Tola_0939Help
Entry
Tola_0939         CDS       T00904                                 

Definition
(GenBank) tryptophan synthase, alpha subunit
  KO
K01695  
tryptophan synthase alpha chain [EC:4.2.1.20]
Organism
tau  Tolumonas auensis
Pathway
Glycine, serine and threonine metabolism
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of antibiotics
Biosynthesis of amino acids
Module
Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tola_0939
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    Tola_0939
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tola_0939
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.20  tryptophan synthase
     Tola_0939
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-ProteinID: 
JGI: 
UniProt: 
Position
complement(1019402..1020208)
Genome map
AA seq 268 aa AA seqDB search
MSRYTALFEHLNAANQGAFVPFITIGDPNPAQSEQIIEALIAGGADALELGIPFSDPVAD
GPTIQDAATRALNSHTTTAICFDILSRIRAKYPDLPIGLLLYANLVYTHTPEDFFKKAKA
AGVDSVLIADVPVEMSVPFKAAADQFGIESIYIAPPNADDETLKTVARLSSGYTYLLSRA
GVTGAETRAQMPVDHLLTALKEFGAPPALLGFGISEPEQVKAAITAGAAGAISGSAVVKI
IEHNLNEPAVMLDKLTQFVKKMKAATLR
NT seq 807 nt NT seq  +upstreamnt  +downstreamnt
atgagccgttataccgcactgtttgaacacctgaatgcggctaatcagggagcttttgtc
ccatttatcacgattggcgatccgaaccctgcgcagtctgagcagatcatcgaagcactg
attgccggcggcgctgacgcactggagctggggatcccattctctgatccggttgccgat
ggcccgacgattcaggatgcggcaacgcgcgccctgaattcacatacaacaaccgcgatc
tgctttgatattctgtcccggatccgcgctaaataccctgatttgccaatcggcttattg
ctgtatgccaatctggtctatacccatacacctgaggatttctttaagaaagccaaggca
gcaggtgtggattcagtcctgattgctgatgtaccggtagaaatgtctgtgccattcaag
gcagcagcagatcaattcggtattgagagcatttatattgcgccaccaaatgcggatgat
gaaacgctgaaaaccgtcgcccgactaagctccggttacacctatctgctgagtcgtgcc
ggtgttaccggtgcagaaacccgggctcagatgcctgtggatcatctgttaaccgcactg
aaagagtttggtgcaccaccagcgctgctgggctttggtatcagtgaacctgaacaggta
aaagccgctattactgccggtgccgcaggtgcaatctctggttctgctgtagttaaaatc
atcgaacataatctgaatgaacccgcagtgatgctggacaaactgacgcagttcgtgaag
aagatgaaagcagccacactgcgctga

DBGET integrated database retrieval system