KEGG   Tolumonas auensis: Tola_0941Help
Entry
Tola_0941         CDS       T00904                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase., Phosphoribosylanthranilate isomerase
  KO
K13498  indole-3-glycerol phosphate synthase / phosphoribosylanthranilate isomerase [EC:4.1.1.48 5.3.1.24]
Organism
tau  Tolumonas auensis
Pathway
tau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01130  Biosynthesis of antibiotics
tau01230  Biosynthesis of amino acids
Module
tau_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tola_0941
Enzymes [BR:tau01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Tola_0941
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.24  phosphoribosylanthranilate isomerase
     Tola_0941
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS PRAI QRPTase_C
Motif
Other DBs
NCBI-ProteinID: ACQ92569
JGI: Tola_0941
UniProt: C4LC90
Position
complement(1021438..1022820)
Genome map
AA seq 460 aa AA seqDB search
MLFNQALASTVLGKIVADKEIWIAARKVSQPLETFQNELKPSDRDFVGGLRGKTAFILEC
KKASPSKGLIREDFSPSAIAKIYGKYASAISVLTDEKYFQGDFAFLPQVRKEVSVPVLCK
DFIIDPYQIYLARHHQADAVLLMLSVLNDEQYRELAAVAKSLNMGVLTEAISEEEINRAI
ELGAEVIGINNRDLRDLKIDLDRTRKLAPLVPEDRIVICESGIYHHAQVKDLAHYANGFL
VGSSLMEEADVDMACRKLILGQNKVCGLTRAEDAKAAYAAGAVFGGLIFVEGSPRCVSVA
QARAITEASPLNFVGVFRNENKEMIQSLVETLQLSAVQLHGDETESYIKKLRSLIPGCQI
WKAVAVSDALPDLNFTADRLLLDSKVGDQSGGTGQSFDWSLLADLPKEKLMLAGGINPEN
ISEALKVGALGLDLNSGVESAPGIKDADKIQRAFAALRAY
NT seq 1383 nt NT seq  +upstreamnt  +downstreamnt
atgttgtttaatcaggcgctcgcctcaaccgtgctgggtaaaattgttgcagataaagaa
atttggattgcagcccgcaaggtaagtcagccattggaaacattccagaatgagctgaag
ccaagtgatcgtgattttgttggtggcttacgtggcaagacggcctttatcctggaatgc
aaaaaagcatcaccttccaaagggctgattcgggaagatttctcgccatccgcaattgcg
aaaatctacggcaaatatgcttccgcgatttctgttctgaccgatgaaaaatacttccag
ggcgattttgcatttctgccacaagtacgcaaagaagtatctgtacccgtgctgtgtaag
gatttcatcatcgatccttatcagatttatctggcgcgtcatcaccaggcggatgctgtt
ttgctgatgctttcggttctgaacgatgagcaataccgtgaactggcagccgtcgcgaaa
tcactgaatatgggtgtactaaccgaagcgatcagtgaggaagagatcaaccgcgcgatt
gaactgggtgcggaagtaattggtatcaataaccgtgacctgcgcgatctgaagattgat
ttggaccgcaccagaaaactggcaccgctggttccggaagatcggatcgtgatctgtgag
tccgggatctatcaccatgctcaggtcaaagatctggcgcactatgcgaatggtttcttg
gtgggcagttcactgatggaagaagctgatgtcgatatggcctgccgcaaactgattttg
ggtcagaataaagtttgtggcctgacccgggcggaagatgctaaagcggcatacgctgcc
ggtgcggtattcggcggtttgatctttgttgaaggtagccctcggtgtgtttccgttgca
caggcccgtgctattaccgaagcttcgccactgaattttgtcggcgtgttccgtaatgaa
aacaaagagatgatccaatcgcttgttgaaacactccagctcagcgccgtgcaattacat
ggtgatgaaacagagagctatattaagaaattacgttcgctgatccctggctgtcagatc
tggaaagccgtggctgtaagcgatgcattaccagatctgaatttcaccgcagatcgttta
ctgctggatagcaaagtaggtgatcaaagcggcggaaccggtcagagttttgactggtca
ctgcttgcagatttaccaaaagaaaaactgatgctggccggtggaattaatccggagaac
atctctgaggcacttaaagttggcgccctcggtctggatttaaactctggcgtagaaagt
gcgcctggcattaaagatgcggacaaaattcagcgtgcctttgctgcgctgcgtgcttat
tga

DBGET integrated database retrieval system