KEGG   Tolumonas auensis: Tola_1021Help
Entry
Tola_1021         CDS       T00904                                 

Gene name
glk
Definition
glucokinase (EC:2.7.1.2)
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
tau  Tolumonas auensis
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tola_1021 (glk)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_1021 (glk)
   00052 Galactose metabolism
    Tola_1021 (glk)
   00500 Starch and sucrose metabolism
    Tola_1021 (glk)
   00520 Amino sugar and nucleotide sugar metabolism
    Tola_1021 (glk)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tola_1021 (glk)
   00524 Butirosin and neomycin biosynthesis
    Tola_1021 (glk)
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     Tola_1021 (glk)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1106046..1107011
Genome map
AA seq 321 aa AA seqDB search
MAEQVLVGDVGGTNARLALCSLQDGSLSHIKNYSGAEYPSLEAVIRVYLEETAAKVSSAC
IAIACPITGDWVAMTNHTWAFSQSEMQQNLGLQHLSIINDFTAISMAIPALKDEDKIQFG
GEAAQAGKPIAVYGAGTGLGVAHLVHSGEAWMSLPGEGGHVDFAPNSTEEVMVLEALREE
LGHVSAERLLSGPGLVNIYRGLVLSDDRVPENLQPKDVTERALADEDIDCRRALSLFCVL
MGRFGGNLALNLGTFGGVYIAGGIVPRFLEFFKASGFRVAFEDKGRFHSYLEPIPVFLIT
HEQPGLLGSGAYLRQKLGYKL
NT seq 966 nt NT seq  +upstreamnt  +downstreamnt
atggctgaacaagttctggtgggcgatgttggtggtacaaatgctcgtctggcgttgtgt
agtttgcaggatggtagcttatcgcacatcaaaaactattccggtgcggaatatccgtca
cttgaggcggtgatccgggtttatctggaagaaacggctgctaaagtttccagtgcatgt
atcgcgattgcctgcccgattacaggtgactgggtggcgatgactaaccatacctgggca
ttctctcaaagcgaaatgcagcaaaatctggggctgcaacacctttctatcatcaatgat
ttcaccgctatctctatggctatcccggcgctgaaagatgaagacaaaattcagttcggt
ggtgaggctgcacaggccggtaagcctatcgctgtctacggtgccggtactggcctgggc
gtagcgcatctggttcatagcggagaagcctggatgagcttgccgggcgagggtggtcat
gtcgattttgcacctaacagcactgaagaagtcatggtgctggaagcattgcgtgaagaa
ctgggccatgtgtctgctgaacgtctgttatcgggtccgggtctggtcaatatctatcgt
ggcttggttctgtcagatgaccgtgtaccggaaaatctgcagccgaaagatgtgactgag
cgtgcactggcggatgaagatatcgactgtcgtcgtgcgctgagcctgttctgtgtgctg
atgggccgtttcggcggtaacctggcgctgaacctgggcaccttcggtggtgtctatatc
gccggtggtatcgtaccgcgcttcctggaattctttaaagcatccggcttccgcgttgcg
tttgaagataaaggccgtttccactcttatctggaaccgatcccggtatttttgatcacg
catgaacaaccgggcctgctgggttctggtgcttacttacgtcagaaactgggttacaaa
ctctga

DBGET integrated database retrieval system