KEGG   Tolumonas auensis: Tola_1200Help
Entry
Tola_1200         CDS       T00904                                 

Definition
molybdenum ABC transporter periplasmic molybdate-binding protein
Orthology
K02020  
molybdate transport system substrate-binding protein
Organism
tau  Tolumonas auensis
Pathway
ABC transporters
Module
Molybdate transport system
Class
Environmental Information Processing; Membrane transport; ABC transporters [PATH:tau02010]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
1311751..1312506
Genome map
AA seq 251 aa AA seqDB search
MLSLRKNQITVALLLLTPYLSFADEVKVAVAANFAQPLEEIGQSFQKDTGHTLLISSGAT
GKLFTQIQNGAPFEVMVSADSKTPKKLVKAELALADTQFTYAKGKLVLWSADANTVDSKG
EVLKTDKYAHLAVGNPKTAPYGTAAYEVLEKLGLMATVSTKLVQGENITQVKQFVDTGNA
ELGFVATSQVYKDGKLVKGSAWEVPLDMYSPLTQDAVLLKKGEDNPAAVELLNYLKGDKA
KAIIHSYGYID
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgttgtcattacgtaaaaatcagatcactgttgctttattgctgttaacgccatacctc
tcttttgctgatgaagtaaaagttgcggtcgctgccaacttcgcgcaaccactcgaagaa
attggtcaatcatttcagaaagacaccggtcataccttattgatctcttcaggggctacc
ggcaagttatttacccaaattcagaatggtgcgccatttgaagtgatggtgagtgctgac
agcaaaacacctaaaaagctggtgaaggccgaactggcgctggcagatacgcaattcacc
tatgccaaaggtaaattggtgttgtggtctgccgatgccaataccgttgatagtaaaggc
gaagtgctgaaaacggataaatatgcccatctggctgtcggtaaccctaaaaccgcacct
tacggaacggctgcttatgaagtgctggaaaaactggggttgatggccactgtgagtacc
aaactggttcagggtgaaaacattactcaggtgaaacaatttgtggataccggtaatgct
gagctcggttttgttgcaacttctcaggtttacaaagacggcaagctggttaaaggttct
gcctgggaagtgccgctcgatatgtacagtccgctgacacaagatgcggtgttactgaag
aagggtgaagataatcctgccgctgttgaactgctgaattatctgaaaggtgacaaggca
aaagcgattattcatagctacggctatattgactaa

DBGET integrated database retrieval system