KEGG   Tolumonas auensis: Tola_1458Help
Entry
Tola_1458         CDS       T00904                                 

Gene name
tpiA
Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tau  Tolumonas auensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tola_1458 (tpiA)
   01230 Biosynthesis of amino acids
    Tola_1458 (tpiA)
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_1458 (tpiA)
   00051 Fructose and mannose metabolism
    Tola_1458 (tpiA)
   00562 Inositol phosphate metabolism
    Tola_1458 (tpiA)
Enzymes [BR:tau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tola_1458 (tpiA)
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tola_1458 (tpiA)
  Exosomal proteins of bladder cancer cells
   Tola_1458 (tpiA)
  Exosomal proteins of melanoma cells
   Tola_1458 (tpiA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1609079..1609834)
Genome map
AA seq 251 aa AA seqDB search
MRQPLIMGNWKLNGTKASVEALINGLKAPAAAAANVEVAVCPSVIFLGQVEQLTAGSAIK
FGSQDADLHTAGAFTGENSPVMLKEFGCKYALVGHSERRTLHAETDAVVAAKYVAIQAAG
LIPVLCIGETLEQFEANETNAVVEAQLKAVIDVAGIESFANAVVAYEPVWAIGTGKTATP
EIAQTVHAHIRAYLAGFNAAVAAKVQVLYGGSMNAANAAELLAQTDIDGGLIGGASLKVE
DFSTIIAAAAK
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atgagacaaccactgatcatgggtaactggaaactgaacggtactaaagcttctgttgaa
gcgctgatcaacggcctgaaagcgccggcagctgctgcagcaaatgttgaagtggctgtt
tgcccttccgttatcttcctgggtcaagttgaacagctgactgccggttctgcgatcaaa
ttcggttcacaagatgctgacctgcacactgctggcgctttcaccggtgaaaactctccg
gttatgctgaaagaattcggctgtaaatacgctctggttggtcacagcgaacgtcgtact
ctgcacgcagaaactgacgctgttgttgctgcaaaatacgttgcaattcaggctgctggc
ctgatccctgttctgtgcattggtgaaactctggaacagttcgaagcaaacgaaactaat
gctgttgttgaagctcagctgaaagctgttatcgacgttgctggtatcgaatcttttgct
aacgcagttgttgcttacgaaccagtatgggctatcggtaccggtaaaactgctactcct
gaaatcgctcagactgtacacgctcacatccgtgcttacctggctggtttcaacgctgcc
gttgctgctaaagtacaggttctgtacggtggttccatgaacgctgcaaacgctgctgaa
ctgctggctcagactgacatcgacggtggtctgattggtggcgcatctctgaaagtagaa
gatttctctactatcatcgctgctgcagctaagtaa

DBGET integrated database retrieval system