KEGG   Tolumonas auensis: Tola_1831Help
Entry
Tola_1831         CDS       T00904                                 

Definition
carbohydrate kinase FGGY
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
tau  Tolumonas auensis
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tola_1831
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     Tola_1831
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tola_1831
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(1997613..1999094)
Genome map
AA seq 493 aa AA seqDB search
MLKPFIIAIDEGTTNAKAITVDSDGNIVAKGSVPVSLNHPKPGWAEQDPWQIWNATEQAI
TQCLQSSDISALKGIAVSNQRESVLVWERQSGQPLTPIVSWQCRRSEALCREIANKPEAA
RVIQLTGLALDPLFPAAKIAWLLDSLQDGRHRAEAGELCVGTVDAWLVWNLTGGESFVTD
HSNASRYQLFNIHTLSWDDELLRIFGIPRACLPKVLPSSELRGDTKGCASLPDGIPVLSQ
VGDSHAALYGQGGFNPGTVKATYGTGSSLMTRIDKAPVGDFGLSSTVAWHDGEASLALEG
NITHTGAGLAFVSRILGINDFDKLSQMAESVENNAGVYFVPALSGLGAPYWDTQARGMFC
GLTDATTPAVMARAGLESIAYQIADVFHAMEQAAGCRLDALLVDGGATKNRWLMQFQADL
LQRTIVRNQVAEISALGAAYLAGKAIGWWKDHQQLSALPREVEYIEPRAQSAEMLANYLQ
WKTAVARARFQPK
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgcttaagccttttatcattgctattgatgaaggcaccaccaatgccaaagcgatcact
gttgattctgatggcaatattgtcgcgaaaggtagtgtgcctgtctctctgaaccacccc
aagccggggtgggcagaacaggatccgtggcaaatctggaatgcaactgaacaggcgatt
acgcaatgtcttcaatcttcagatatttcagctctgaagggaattgcggtcagtaatcag
cgtgagtcagttctggtatgggaacgccagtcaggtcagccgttaacacctattgtcagt
tggcaatgccgtcgctctgaagcactttgccgggagatagccaataaaccggaagcagcc
cgtgtcatacagctaaccggattagcgctggatccattgttcccggcagccaagatcgcc
tggttgctggatagccttcaggatggtcgtcaccgcgcagaagcaggtgaactttgtgtc
ggaacggttgatgcgtggctggtctggaatctgaccggtggcgagtcgttcgttaccgat
cattctaatgcatcgcgttatcagttattcaacatccataccctgagctgggatgatgaa
ttacttcgtatttttggtattccccgggcctgtttgccgaaggttctgccatcgtctgaa
ctgcgaggtgataccaaagggtgtgcctctttaccggatggtattcccgtgctgtcgcag
gtcggtgattcgcatgccgcgctatatggccagggcgggtttaatcccgggacagtcaaa
gccacttatggcacaggcagttcgttgatgacccgcatcgataaagcgcctgtcggtgat
ttcggtttgagttcaacggttgcctggcatgacggtgaagcgagtctggctttggaaggc
aatatcactcataccggtgctggcctggccttcgtttcccgtattttgggaattaatgat
ttcgacaaactgagtcagatggcggaatcagtagaaaataatgccggagtttacttcgtc
cctgcgttatcaggattgggtgcaccttactgggatactcaggcccgcgggatgttctgc
ggactcaccgatgccactacgccagccgtgatggctcgtgctggtcttgagtcaatcgct
tatcaaatcgccgatgtgttccatgctatggaacaagctgcgggttgtcgtctggatgcc
ttgctggttgatggtggtgccaccaaaaatcgttggctgatgcaattccaggcggattta
ctgcaaagaaccatcgtccgtaatcaggtggcggaaatttcagccttaggggcagcctat
ctggcagggaaagcgattggttggtggaaagatcaccaacagttatctgcattgccacgg
gaagtggaatatatcgaaccaagagcgcaatcagcagaaatgctggctaactatctgcaa
tggaaaacggccgttgctcgtgcccgttttcagcctaaataa

  All links  
No link information was found.   
DBGET integrated database retrieval system