KEGG   Tolumonas auensis: Tola_2010Help
Entry
Tola_2010         CDS       T00904                                 

Definition
glycoside hydrolase family protein
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
tau  Tolumonas auensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tau00052]
Metabolism; Lipid metabolism; Glycerolipid metabolism [PATH:tau00561]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tau00600]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2198288..2199649
Genome map
AA seq 453 aa AA seqDB search
MTTKIVLIGAGSAQFGYGTLGDIFQSKTLAGSEIVLHDINPKALALTEETARKFVAEQDL
PFTIRATTNRKDALKGANFIMISIEVGDRFALWDMDWQIPQQYGIKQVYGENGGPGGLFH
SLRIIPPILAICEDIAAICPDAWIFNYSNPMSRICTTVHRKFPELNFVGMCHEIASLERY
LPEILNTPFSNLAVRAGGLNHFSVLLNANYRDSGKDAYADIRAKAPAYFEKLPGFADILS
YTRKHGKLIETEGATERDAMGGIDSAYPWADRTLFKEILEKFNYLPITGDSHFGEYIRWA
YDVSDHRGILDFYAFYRNYLGHVEPKIELKLKERVVPIIEGILTNAGYEEAAVNIPNKGY
IRQLPGFISVEVPAIIDSKGVHGIQLEMPAGIGGLLANQVAVHDLTAEAVLNQSRELVIQ
ALLVDSVNDKCRCIPELVDLMISRQSPYLDYLK
NT seq 1362 nt NT seq  +upstreamnt  +downstreamnt
atgacaaccaagatcgtccttatcggtgcaggcagtgctcagtttggttatggcacactg
ggtgatattttccagagcaaaacactggcaggcagtgaaatcgtattacacgacatcaac
ccgaaagcattggcattaaccgaagaaactgcccgtaaatttgttgcggagcaagatctg
ccattcaccatccgcgctaccaccaacagaaaagatgccctgaaaggcgcaaatttcatc
atgatctccattgaagtcggcgatcgctttgcgctgtgggatatggactggcaaatacca
cagcaatacggcattaaacaggtttacggcgagaatggcggtccgggcggtctgttccat
tccctgcgcattattccgccgattctggcgatctgtgaagatatcgcagctatctgcccg
gatgcctggatcttcaattactccaacccgatgagccgcatctgcaccaccgtacaccgt
aagttccctgaactgaactttgtcggcatgtgccacgaaatcgcctcgctggaacgttat
ctgcctgaaattctgaatacaccgttcagcaatctggccgtacgcgccggtggtctgaac
catttcagtgtgctgctgaatgccaattaccgtgactcaggcaaagacgcttacgccgat
atccgcgccaaagcgccagcttattttgaaaaattaccgggttttgccgatattctgagc
tatacccgcaagcacggaaaactgattgagaccgaaggtgctaccgagcgggatgccatg
ggcggtatcgacagtgcgtatccttgggcagacagaacactgtttaaagaaatactggag
aaatttaactatctgccgattaccggtgacagccactttggtgagtacatccgctgggcg
tatgacgtcagcgatcatcgcggtatcctcgatttctacgccttctaccgtaactacctg
ggtcatgttgagccgaaaatcgaactgaaactcaaagaacgcgtcgtcccgatcattgaa
ggcatactcaccaatgccggttatgaagaggccgcagtgaatattccgaacaaaggttat
atcagacaactgccgggattcatctctgttgaagtaccggcaattatcgacagcaaaggc
gtacatggcatccagctggaaatgccggcaggtatcggtgggttgttagcgaatcaggtg
gcagtccatgatctgaccgcagaagcggttctgaatcagtcacgtgagctggtaatacag
gcattgctggttgattctgtaaacgataaatgccgctgcatcccggaactggttgatctg
atgatctcccggcagtccccttatctcgactacctgaaataa

DBGET integrated database retrieval system