KEGG   Tolumonas auensis: Tola_2039Help
Entry
Tola_2039         CDS       T00904                                 

Definition
(GenBank) dTDP-glucose 4,6-dehydratase
  KO
K01710  dTDP-glucose 4,6-dehydratase [EC:4.2.1.46]
Organism
tau  Tolumonas auensis
Pathway
tau00521  Streptomycin biosynthesis
tau00523  Polyketide sugar unit biosynthesis
tau00525  Acarbose and validamycin biosynthesis
tau01130  Biosynthesis of antibiotics
Module
tau_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tola_2039
   01055 Biosynthesis of vancomycin group antibiotics
    Tola_2039
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tola_2039
   00525 Acarbose and validamycin biosynthesis
    Tola_2039
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.46  dTDP-glucose 4,6-dehydratase
     Tola_2039
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GDP_Man_Dehyd Epimerase NAD_binding_4 Polysacc_synt_2 3Beta_HSD RmlD_sub_bind adh_short
Motif
Other DBs
NCBI-ProteinID: ACQ93638
JGI: Tola_2039
UniProt: C4L7M2
Position
complement(2225199..2226263)
Genome map
AA seq 354 aa AA seqDB search
MKKLLVTGGAGFIGANFVHYWLKTHPADRVVVLDALTYAGNIETLRPLMDNPNFRFVKGN
ICNSELVEMLLRDEQIDTLVHFAAESHVDRSITGPDAFIETNIIGTHSLLKAARAVWLAD
PANPLPHRFHHVSTDEVYGTLELTDPAFTESTAYAPNSPYSASKAASDHLVRAYHHTYGL
QVTTSNCSNNYGYFHFPEKLIPLCLTNILDNKALPIYGDGKQIRDWLFVEDHCSGIELVL
NKGVIGETYNIGGVNEWQNIDIVHLICELVDGEFAADNSLASRYPLSPCAKGESAKSLIT
YVTDRAGHDRRYAVGTEKIQSELGYQPQETFQTGIAKTIKWYLANESWWRPLKK
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaattactcgttaccggcggtgccggctttatcggtgctaactttgtacattac
tggctgaaaacccatccggctgatcgcgtagtggtgctggatgcgctgacttacgcaggc
aatatcgaaacgctgcgtccgctgatggataacccgaatttccgttttgtaaaaggcaat
atctgcaattctgaactggttgaaatgctgctgcgtgatgagcagatcgatacgctggtg
cattttgcggcagagtcacatgtcgatcgctctatcactggtccggatgcctttattgaa
accaacatcatcggcacccacagtctgctgaaagctgcacgcgcagtgtggctggctgat
ccggcaaacccgttgccgcatcgtttccaccatgtctctaccgatgaagtgtacggcaca
ctggaactgactgatccggctttcaccgagtcaaccgcctatgcgccgaattcaccatat
tccgcgtccaaagcagcttccgatcatctggtgcgtgcttatcaccatacctatggtctg
caggtgactaccagcaactgttccaataactacggctatttccacttcccggaaaaactg
attccgctgtgcctgaccaacattctggataacaaagcattgccgatttacggtgatggc
aagcagatccgcgactggttattcgtggaagatcactgcagtggtatcgagctagtactg
aataaaggcgtgatcggcgaaacctacaatatcggtggtgttaacgaatggcagaacatt
gatattgtgcatctgatctgtgaactggtggacggtgaattcgctgctgataactcgctg
gcgtcgcgttacccattatcgccttgtgcgaaaggtgaatcagcaaaatcattgatcact
tatgtgactgatcgcgctggccacgatcgccgttacgcggtaggtactgagaaaatccag
agtgagctgggctatcagccacaggaaaccttccagactggtattgccaaaaccatcaaa
tggtatctggcgaatgaaagctggtggcgtccgttgaagaaataa

DBGET integrated database retrieval system