KEGG   Tolumonas auensis: Tola_2040Help
Entry
Tola_2040         CDS       T00904                                 

Definition
(GenBank) dTDP-4-dehydrorhamnose 3,5-epimerase
  KO
K01790  dTDP-4-dehydrorhamnose 3,5-epimerase [EC:5.1.3.13]
Organism
tau  Tolumonas auensis
Pathway
tau00521  Streptomycin biosynthesis
tau00523  Polyketide sugar unit biosynthesis
tau01130  Biosynthesis of antibiotics
Module
tau_M00793  dTDP-L-rhamnose biosynthesis
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of terpenoids and polyketides
   00523 Polyketide sugar unit biosynthesis
    Tola_2040
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    Tola_2040
Enzymes [BR:tau01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.13  dTDP-4-dehydrorhamnose 3,5-epimerase
     Tola_2040
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: dTDP_sugar_isom
Motif
Other DBs
NCBI-ProteinID: ACQ93639
JGI: Tola_2040
UniProt: C4L7M3
Position
complement(2226279..2226827)
Genome map
AA seq 182 aa AA seqDB search
MKIIDTSIPDVKIIEPAVFGDERGFFMETWQEQKFNELVCERRFVQDNHSKSRQGILRGL
HYQTEQAQGKLVRVIAGEVFDVAVDIRRSSPTFGQSVGVLLSAENKRQLWVPEGFAHGFY
VTTETAEFVYKCTNYYNPSAEHSIRWNDPELNIQWPLVDGQQPSLSAKDAEGKLFKDAVY
FD
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaaaattatcgatacttctatccctgacgtaaaaattattgagccggctgtatttggt
gatgagcgcggtttctttatggaaacctggcaggaacagaaatttaatgaactggtgtgt
gaacgccggtttgtacaggataaccactccaagtcccgtcagggtattctgcgtggtttg
cattaccagacagaacaggcccaaggcaaactggtgcgtgtcatcgccggtgaagtattt
gatgttgctgtcgatattcgccgttcatcgccaacatttggccagtcggtgggtgtgctg
ttgtctgcagaaaacaaacgtcagttatgggtgccggaaggtttcgcacatggtttctat
gtaacaacagaaaccgctgaatttgtgtataaatgcacaaattattacaacccgtctgct
gaacattctattcgctggaatgacccggagctgaatatccagtggccactggttgatggc
cagcaaccatcactttctgccaaagatgccgaaggcaaattattcaaagatgcggtttat
ttcgactaa

DBGET integrated database retrieval system