KEGG   Tolumonas auensis: Tola_2117Help
Entry
Tola_2117         CDS       T00904                                 

Definition
glycoside hydrolase clan GH-D
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
tau  Tolumonas auensis
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tola_2117
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tola_2117
   00600 Sphingolipid metabolism
    Tola_2117
Enzymes [BR:tau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tola_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2314756..2316873
Genome map
AA seq 705 aa AA seqDB search
MKENVVHLQGKTSDLIIQTSPAVEILYWGDKISGVDAAAIQAVRRAVPNGRLDVDTPVTI
SPEQGRGVFSSPGMEGHRQGLDWSPVFNFKSIRQDNNNLLLTTEDPIAGLRLVCELNLDP
KTDVLQVRHTLTNLKPENYQVDRFAVTLPLPERADELMAFHGRWVREFQPHRVKVKHGGY
QQENRRGRTSHEYFPGLMQGAAGFSEQQGEVWGFHLAWSGNHRLRSDVKTDGRRFVQAEA
LYFSGEIVLAEGESISTPWVYATYSALGLNGMSHAFHQFVRDQIVHFPEDKPRPVHLNTW
EGIYFDHDPEYIMQMASRAAELGVERFIIDDGWFKGRNNDLAALGDWYLDTKKYPNGLEP
VVSHVRGLGMEFGIWVEPEMINPDSDLFRAHPDWLLAVDGYQQPTGRYQYVLDLQKPEVF
DYLLERMDNLLGSYDIAYVKWDMNREVVQPGHDGYAALDGQTKALYDLFDELRQRHPKVE
FESCASGGGRIDYEILKRTHRFWTSDNNDALERQHIQRGMSYFFPPEVMGAHIGGRHCHC
TRRTHSIGFRGLTALFGHMGVELDPVKESAEERAGFTHYIALHKQIRPLLHSGKVVRIDH
HDAALQINGVIAQDQSSAVFLFSQLAMPTYTLSGTARFDGLDPAKQYRLTVLDQPANLRT
GGIMKKLPLWLEEETTLSGAWLAKAGIALPVMDPESAMLIKLEAV
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaacgtagttcatctgcaaggcaagacgtctgatctgattattcagacctca
cctgccgttgaaattttatattggggcgacaaaatttccggtgtcgatgcggcggcgatt
caggcagtaagacgcgcagtaccgaatggtcgtctggatgttgacactccggtgacgatc
agtccggaacaaggccgtggcgtattcagcagcccgggtatggaaggtcaccgtcaggga
ctggactggtctccggtattcaatttcaaatcgatccggcaggacaacaataatctgctg
ctcaccactgaagatccgattgctggtttgcgcctggtgtgtgaattgaatctggatcca
aaaaccgatgtattgcaggttcgccataccttaaccaacctgaagcctgagaattatcag
gtggatcgcttcgcggtgaccttaccgttgccggaacgtgctgatgagctgatggcattc
catggtcgctgggttcgtgaattccagccgcaccgcgtgaaagtcaaacacggtggttat
cagcaggaaaaccgtcgtggccgtacttctcatgaatatttccctggcttgatgcagggt
gctgccggttttagcgaacaacaaggtgaagtctggggcttccatctggcgtggagtggt
aaccatcgcctgcgttctgacgtgaaaaccgatggtcgccgttttgtacaggcggaagca
ctttatttctccggtgaaatcgttttggcggaaggcgaaagtatcagtactccatgggtc
tatgccacttacagtgctctgggtctgaatggcatgagccatgcgttccaccagtttgtc
cgtgatcagatcgtgcacttcccggaagacaaaccacgtccggtacatctgaacacatgg
gaagggatctattttgatcacgatccggaatacatcatgcagatggccagccgggccgca
gagctgggtgtggaacgtttcattattgatgatggctggtttaaaggccgtaacaatgat
ctggccgcattgggtgactggtatctggataccaaaaaatatccgaatggtctggagcca
gtcgtcagccatgtccgtggcttaggtatggaattcgggatctgggttgaaccggaaatg
atcaatccggactccgatctgttccgtgcacatccggactggttactggctgttgacggc
tatcagcaaccgaccggtcgttatcagtacgtgctggatctgcaaaaaccggaagttttc
gattacctgctggaacgcatggacaatctgctgggcagctatgacatcgcttatgtgaaa
tgggatatgaaccgcgaagtcgttcagccgggtcatgacggttatgcggcactggatggt
cagacgaaagcactgtatgacctgttcgatgagctgcgtcagcgtcatccgaaagtagaa
tttgaatcttgtgcgtccggtggtggtcgtatcgattatgaaattctgaaacgcactcac
cgcttctggacttctgataataacgatgcgctggaacgtcagcatattcaacgagggatg
agctatttcttcccaccggaagtgatgggcgcgcacattggtggtcgtcattgtcactgt
acccgtcgcacacacagcattggtttccgcggtctgactgcactgtttggtcatatgggt
gtcgaactggatccggtcaaggaaagcgccgaagagcgtgccggttttacccattacatt
gcactgcataaacagatccgcccattgctgcacagcggcaaagtggtacgtatcgatcac
catgacgctgcactgcagatcaatggcgtgattgctcaggaccaatccagtgcggtgttc
ctgttcagtcagctggcgatgccaacttatactctgtccggcactgcccgttttgatgga
cttgatccggcaaaacaatatcgtctgacggtattggatcaaccggccaatctgcgtacc
ggtggcattatgaaaaaactgccattgtggctggaagaggaaaccactctgagcggtgcc
tggttagcaaaagccgggattgctctgccggtgatggatccggaaagcgctatgttaatc
aaattggaagccgtgtaa

DBGET integrated database retrieval system