KEGG   Tolumonas auensis: Tola_2117Help
Entry
Tola_2117         CDS       T00904                                 

Definition
(GenBank) glycoside hydrolase clan GH-D
  KO
K07407  alpha-galactosidase [EC:3.2.1.22]
Organism
tau  Tolumonas auensis
Pathway
tau00052  Galactose metabolism
tau00561  Glycerolipid metabolism
tau00600  Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    Tola_2117
  Lipid metabolism
   00561 Glycerolipid metabolism
    Tola_2117
   00600 Sphingolipid metabolism
    Tola_2117
Enzymes [BR:tau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     Tola_2117
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Melibiase Glyco_hydro_36N Glyco_hydro_36C Glyco_hydro_31 Melibiase_2
Motif
Other DBs
NCBI-ProteinID: ACQ93716
JGI: Tola_2117
UniProt: C4L870
Position
2314756..2316873
Genome map
AA seq 705 aa AA seqDB search
MKENVVHLQGKTSDLIIQTSPAVEILYWGDKISGVDAAAIQAVRRAVPNGRLDVDTPVTI
SPEQGRGVFSSPGMEGHRQGLDWSPVFNFKSIRQDNNNLLLTTEDPIAGLRLVCELNLDP
KTDVLQVRHTLTNLKPENYQVDRFAVTLPLPERADELMAFHGRWVREFQPHRVKVKHGGY
QQENRRGRTSHEYFPGLMQGAAGFSEQQGEVWGFHLAWSGNHRLRSDVKTDGRRFVQAEA
LYFSGEIVLAEGESISTPWVYATYSALGLNGMSHAFHQFVRDQIVHFPEDKPRPVHLNTW
EGIYFDHDPEYIMQMASRAAELGVERFIIDDGWFKGRNNDLAALGDWYLDTKKYPNGLEP
VVSHVRGLGMEFGIWVEPEMINPDSDLFRAHPDWLLAVDGYQQPTGRYQYVLDLQKPEVF
DYLLERMDNLLGSYDIAYVKWDMNREVVQPGHDGYAALDGQTKALYDLFDELRQRHPKVE
FESCASGGGRIDYEILKRTHRFWTSDNNDALERQHIQRGMSYFFPPEVMGAHIGGRHCHC
TRRTHSIGFRGLTALFGHMGVELDPVKESAEERAGFTHYIALHKQIRPLLHSGKVVRIDH
HDAALQINGVIAQDQSSAVFLFSQLAMPTYTLSGTARFDGLDPAKQYRLTVLDQPANLRT
GGIMKKLPLWLEEETTLSGAWLAKAGIALPVMDPESAMLIKLEAV
NT seq 2118 nt NT seq  +upstreamnt  +downstreamnt
atgaaggaaaacgtagttcatctgcaaggcaagacgtctgatctgattattcagacctca
cctgccgttgaaattttatattggggcgacaaaatttccggtgtcgatgcggcggcgatt
caggcagtaagacgcgcagtaccgaatggtcgtctggatgttgacactccggtgacgatc
agtccggaacaaggccgtggcgtattcagcagcccgggtatggaaggtcaccgtcaggga
ctggactggtctccggtattcaatttcaaatcgatccggcaggacaacaataatctgctg
ctcaccactgaagatccgattgctggtttgcgcctggtgtgtgaattgaatctggatcca
aaaaccgatgtattgcaggttcgccataccttaaccaacctgaagcctgagaattatcag
gtggatcgcttcgcggtgaccttaccgttgccggaacgtgctgatgagctgatggcattc
catggtcgctgggttcgtgaattccagccgcaccgcgtgaaagtcaaacacggtggttat
cagcaggaaaaccgtcgtggccgtacttctcatgaatatttccctggcttgatgcagggt
gctgccggttttagcgaacaacaaggtgaagtctggggcttccatctggcgtggagtggt
aaccatcgcctgcgttctgacgtgaaaaccgatggtcgccgttttgtacaggcggaagca
ctttatttctccggtgaaatcgttttggcggaaggcgaaagtatcagtactccatgggtc
tatgccacttacagtgctctgggtctgaatggcatgagccatgcgttccaccagtttgtc
cgtgatcagatcgtgcacttcccggaagacaaaccacgtccggtacatctgaacacatgg
gaagggatctattttgatcacgatccggaatacatcatgcagatggccagccgggccgca
gagctgggtgtggaacgtttcattattgatgatggctggtttaaaggccgtaacaatgat
ctggccgcattgggtgactggtatctggataccaaaaaatatccgaatggtctggagcca
gtcgtcagccatgtccgtggcttaggtatggaattcgggatctgggttgaaccggaaatg
atcaatccggactccgatctgttccgtgcacatccggactggttactggctgttgacggc
tatcagcaaccgaccggtcgttatcagtacgtgctggatctgcaaaaaccggaagttttc
gattacctgctggaacgcatggacaatctgctgggcagctatgacatcgcttatgtgaaa
tgggatatgaaccgcgaagtcgttcagccgggtcatgacggttatgcggcactggatggt
cagacgaaagcactgtatgacctgttcgatgagctgcgtcagcgtcatccgaaagtagaa
tttgaatcttgtgcgtccggtggtggtcgtatcgattatgaaattctgaaacgcactcac
cgcttctggacttctgataataacgatgcgctggaacgtcagcatattcaacgagggatg
agctatttcttcccaccggaagtgatgggcgcgcacattggtggtcgtcattgtcactgt
acccgtcgcacacacagcattggtttccgcggtctgactgcactgtttggtcatatgggt
gtcgaactggatccggtcaaggaaagcgccgaagagcgtgccggttttacccattacatt
gcactgcataaacagatccgcccattgctgcacagcggcaaagtggtacgtatcgatcac
catgacgctgcactgcagatcaatggcgtgattgctcaggaccaatccagtgcggtgttc
ctgttcagtcagctggcgatgccaacttatactctgtccggcactgcccgttttgatgga
cttgatccggcaaaacaatatcgtctgacggtattggatcaaccggccaatctgcgtacc
ggtggcattatgaaaaaactgccattgtggctggaagaggaaaccactctgagcggtgcc
tggttagcaaaagccgggattgctctgccggtgatggatccggaaagcgctatgttaatc
aaattggaagccgtgtaa

DBGET integrated database retrieval system