KEGG   Tolumonas auensis: Tola_2176Help
Entry
Tola_2176         CDS       T00904                                 

Definition
(RefSeq) bifunctional acetaldehyde-CoA/alcohol dehydrogenase
  KO
K04072  
acetaldehyde dehydrogenase / alcohol dehydrogenase [EC:1.2.1.10 1.1.1.1]
Organism
tau  Tolumonas auensis
Pathway
Glycolysis / Gluconeogenesis
Fatty acid degradation
Tyrosine metabolism
Pyruvate metabolism
Chloroalkane and chloroalkene degradation
Naphthalene degradation
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01220 Degradation of aromatic compounds
    Tola_2176
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_2176
   00620 Pyruvate metabolism
    Tola_2176
   00650 Butanoate metabolism
    Tola_2176
  Lipid metabolism
   00071 Fatty acid degradation
    Tola_2176
  Amino acid metabolism
   00350 Tyrosine metabolism
    Tola_2176
  Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    Tola_2176
   00626 Naphthalene degradation
    Tola_2176
Enzymes [BR:tau01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     Tola_2176
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     Tola_2176
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2384195..2386864
Genome map
AA seq 889 aa AA seqDB search
MPVTNVAELDELLVRVKKAQREFATFSQEQVDKIFRAAALAANNARIPLAQMAAAESGMG
IVEDKVTKNHFASEYIYNKYKDEKTCGILEEDKTFGTITIAEPIGIICGIVPTTNPTSTA
IFKSLIALKTRNGIVFSPHPRAKNSTAAAARIVLDAAVAAGAPADIVGWIDTPSVEMSNY
LMKHQDINLILATGGPAMVKAAYSSGKPAIGVGAGNTPVVIDETADIKRAVASILLSKTF
DNGVVCASEQAVIVVDSVYDAVKERFASHGGYILNKDEADKVRKVLLINGALNAAIVGQP
ATKIAELAGIKVPSDTKILIGEGAKICYEEEFAHEKLSPSLGMFRAKDFTEAVDFACQMV
DLGGIGHTSALYTDQDKNDDRVRYFGDKMKTARILINTPTSHGGIGDLYNFNLAPSLTLG
CGSWGGNSISENVGPKHLINKKTVAKRAENMLWHKLPKSIYFRRGSLPIALTDLEGKKRA
MVVTDSFLFNNGYADELVTILKDKGMEVEVFYEVAADPTLTIVKKGAEMMRSFKPDVILA
LGGGSPMDAAKIMWVMYEHPETHFEELAMRFMDIRKRIYKFPKMGIKADLVCITTTSGTG
SEVTPFAVVTDDLNGGVKYPLADYELTPTMAIVDANLVMNMPKSLCAFGGVDAVTHAVEA
YVSVLANEYSDGQALQALKLLKEYLPSSYANGSKDPVAREKVHNAATIAGIAFANSFLGV
CHSMAHKLGAEFHIPHGLANALLIANVIRYNANDNPTKQTAFSQYDRPQARRRYSEIADH
LGLTAAGDRTGVKVEKLLTWLEGLKAELDIPASIRDAGVNEAAFLAKVDQLAVEAFDDQC
TGANPRFPLISELKQLLLDSYYGRAYAPEAVTVGEEVKEAKKDEGKKKK
NT seq 2670 nt NT seq  +upstreamnt  +downstreamnt
atgccagtaaccaacgttgctgaattggatgaactgcttgtccgcgttaaaaaagctcaa
cgcgaattcgcaactttcagccaagaacaggtagacaaaatcttccgcgctgctgctctg
gcagcaaacaatgcccgtattcctctggctcagatggcagcagctgaatcaggcatgggt
atcgttgaagataaagtgactaaaaaccacttcgcatctgagtacatttacaacaaatac
aaagacgaaaaaacttgtggcatcctggaagaagacaaaactttcggaaccatcactatc
gctgaaccaatcggtatcatctgcggtatcgttccaactaccaacccgacttctactgca
atcttcaaatctctgattgcactgaaaactcgtaacggtatcgttttctccccgcaccca
cgtgctaaaaattctactgctgctgctgcacgtatcgttctggatgctgctgttgctgcc
ggtgcacctgctgacatcgttggctggatcgataccccatctgtagaaatgtctaactac
ctgatgaaacaccaggacattaacctgatcctggctactggtggtcctgcgatggttaaa
gcggcttactcttcaggtaaaccagctatcggtgtaggcgcaggtaacactccagttgtt
atcgatgaaactgcagacatcaaacgtgctgtagcttctatcctgttgtctaaaactttc
gacaacggcgtagtttgtgcttctgaacaggctgttatcgtagttgattcagtttatgac
gcagtgaaagagcgtttcgcttctcacggcggctatatcctgaacaaagatgaagctgac
aaagttcgtaaagtactgctgatcaacggtgccctgaatgcggcaatcgtaggtcaacca
gcgaccaaaatcgctgaactggctggcatcaaagttccttctgacaccaagatcctgatc
ggggaaggcgctaaaatctgctacgaagaagaattcgctcacgagaaactgtctccatca
ctgggtatgttccgtgctaaagacttcactgaagctgttgacttcgcttgccagatggtt
gatctgggcggtatcggtcatacttcagctctgtacaccgaccaggacaagaacgacgat
cgcgttcgttacttcggtgacaagatgaagactgctcgtatcctgatcaatacccctact
tctcatggtggtatcggtgacctgtacaactttaacctggctccttctctgactctgggt
tgtggttcatggggtggtaactccatctctgaaaacgtaggtccaaaacatctgatcaac
aagaagacagtagctaagcgagcagaaaatatgctgtggcacaaacttcctaaatcaatt
tacttccgtcgcggttctctgccaattgcactgactgacctggaaggcaaaaaacgcgca
atggttgttaccgacagcttcctgttcaacaacggttatgctgacgaactggttaccatc
ctgaaagacaaaggcatggaagtagaagtattctacgaagtggctgcagacccaactctg
accatcgttaagaaaggtgcagagatgatgcgctctttcaaaccagacgtaatcctggcg
ctgggcggtggttcaccaatggacgctgcgaagatcatgtgggttatgtacgagcaccca
gaaactcatttcgaagaactggcaatgcgtttcatggacatccgtaaacgtatctacaag
ttccctaaaatgggtatcaaagctgacctggtatgtatcactactacttccggtaccggt
tctgaagttactccattcgcggtagttactgacgacctgaacggtggcgttaaataccca
ctggctgactacgagctgactccaaccatggctatcgttgatgcgaacctggttatgaac
atgcctaagtcactgtgtgcgttcggtggtgttgatgcggtaactcacgctgttgaagct
tatgtttctgtactggctaacgaatactcagacggtcaagctctgcaagcactgaaactg
ctgaaagaatacctgccaagcagctacgcaaacggttctaaagaccctgttgctcgtgag
aaagtacacaacgcagctaccatcgctggtatcgcgttcgcgaactccttcctgggcgtg
tgccactctatggctcacaaactgggtgctgagttccacattcctcacggtctggctaac
gccctgttgatcgctaacgtaatccgttacaacgcgaacgacaacccaactaaacagact
gcgttctctcaatacgaccgtccacaagcacgtcgtcgttattcagaaatcgctgatcac
ctgggtctgaccgctgctggcgaccgtactggtgttaaagttgaaaaactgctgacttgg
ttggaaggcctgaaagctgagctggacatccctgcatctatccgtgatgctggcgtgaac
gaagctgcgttcctggctaaagttgaccaactggctgttgaagcgttcgatgaccaatgt
actggtgctaacccacgtttcccattgatctctgaactgaaacaactgttgctggactct
tactacggccgtgcttatgctccagaagcagtaaccgttggtgaagaagtcaaagaagct
aaaaaagacgaaggcaaaaagaaaaaataa

DBGET integrated database retrieval system