KEGG   Tolumonas auensis: Tola_2215Help
Entry
Tola_2215         CDS       T00904                                 

Definition
recombination protein RecR
Orthology
K06187  
recombination protein RecR
Organism
tau  Tolumonas auensis
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:tau00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Tola_2215
DNA repair and recombination proteins [BR:tau03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Tola_2215
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2424396..2424998)
Genome map
AA seq 200 aa AA seqDB search
MKFSPLLDALIRELQVLPGVGPKSAQRMAFQLLERERKRGMQLGQTLQRALTEIGHCQHC
RTFTENSLCDICANPKRAESGQLCIVETPADVAAIEQTHLYSGRYFVLMGHLSPLDGIGP
KELGLDQLDNVLQGGQWKEVILATNPTIEGDATAFYIASMAKRYQINITRIAHGVPVGGE
LELVDGTTLSHSLSGRRPLE
NT seq 603 nt NT seq  +upstreamnt  +downstreamnt
atgaagttcagcccactactggatgctctgatccgtgaattacaagtattgcctggtgtc
ggacccaaatcggcacaacggatggcatttcagttgctggagcgcgaacgtaaacgtggt
atgcagttagggcaaaccctgcagcgggctctgacggaaattggccattgtcagcattgc
cgtactttcactgaaaactcgttatgtgatatctgtgcgaatccgaaacgggcggagagt
ggccagctctgtatcgtcgagacaccggctgatgtggcggcgattgaacaaacgcatctt
tattccggtcgttatttcgtactgatggggcacttatctccgctggatggcattggtccg
aaagagctggggctggatcaactggataatgtgctgcaaggcggccagtggaaggaggtg
attctggcgaccaatccaaccattgagggtgatgcgacggcattttatattgccagcatg
gcgaaacggtatcagatcaatatcacccgtattgcgcatggtgtcccggttggcggggag
cttgaactggtggatggaactacattgtcgcattcattaagcggtcgtcgtccgctggag
taa

DBGET integrated database retrieval system