KEGG   Tolumonas auensis: Tola_2228Help
Entry
Tola_2228         CDS       T00904                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
tau  Tolumonas auensis
Pathway
tau00020  Citrate cycle (TCA cycle)
tau00310  Lysine degradation
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01130  Biosynthesis of antibiotics
tau01200  Carbon metabolism
Module
tau_M00009  Citrate cycle (TCA cycle, Krebs cycle)
tau_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Tola_2228
  Amino acid metabolism
   00310 Lysine degradation
    Tola_2228
Enzymes [BR:tau01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Tola_2228
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Adeno_VII
Motif
Other DBs
NCBI-ProteinID: ACQ93826
JGI: Tola_2228
UniProt: C4L8V6
Position
complement(2438410..2439606)
Genome map
AA seq 398 aa AA seqDB search
MTLQIMVPDLPESVSDATIGTWHKKTGERIKAGELLVDLETDKVILEVPAPQDGIIGDIF
FDSGSVVQARQLLAELQEVPASGEETTEKPAPAPDTGDASDILTPSVRRILAEEEVDPSV
LQGSGRDGRLTRQDVLAHLQRQTNDPSATTALIATVDSATETPVSGREEKRVPMTRLRKR
IAERLLEAKNTTAMLTTFNEVNMQPIMQIRSKYQEQFEKRHGIKLGFMSFYVKAVSEALK
RYPEINASIDENDILYHNYFDISIAVSTDRGLVTPVLRNCDELSLAEIEKGIKLLADKAR
DGKLSVEDLTGGTFTITNGGVFGSLMSTPIINPPQSAILGMHKIQDRPMAVDGQVVILPM
MYLALSYDHRIIDGRESVGFLVHVKSLLEDPTRLLLDI
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atgactttgcaaataatggtgcctgatcttcctgaatctgtatctgatgcgaccattggc
acctggcacaaaaaaactggtgaacgcatcaaagctggcgagttgttggttgacctggaa
acggacaaagttatattggaagtaccggctcctcaggatgggatcatcggcgatatcttt
tttgactctggcagtgttgtgcaggccagacaattgctggctgaattgcaggaagtgcct
gcgagtggcgaggagacaacagagaaaccagccccggctcctgataccggcgatgccagc
gatattctgacgccatcggtgcgccgtattctggctgaggaagaggttgacccctctgtg
ttgcaaggctctggccgtgatggtcgtcttacacgtcaggatgtgcttgctcatttacaa
cgtcagacaaatgacccgtcggccacaacagccttgattgcgactgttgattctgcgact
gagactccggtcagtggcagagaggaaaaacgggtgccgatgacccgtctgagaaaacgc
atcgccgagcgtttgctggaagctaaaaataccacggcaatgctgaccacctttaatgag
gtcaacatgcagccgatcatgcagatccgcagtaaatatcaggaacagtttgaaaaacgt
catggtattaagctcggcttcatgtcgttttatgtgaaagccgtcagtgaagcactgaaa
cgctatccggaaatcaacgcctctattgatgaaaatgatattctttatcataattacttc
gatatcagcattgcggtatcaacagaccgtggactggtgaccccggttttacgtaactgt
gatgagttatcgctggctgagattgaaaaaggcatcaaattactggctgacaaagcccgt
gatggcaagctttcggtggaagatcttaccggcggcacgttcaccatcacgaatggcggt
gtttttggttcattgatgtcgacgcccatcattaatcctccgcaaagcgcgattctgggt
atgcataaaatccaggatcgtccaatggctgtggatggtcaggtggtaattcttccaatg
atgtacttggctctgtcgtatgatcaccgtatcatcgacggccgcgagtctgtcgggttt
ctggttcatgtaaaatctttactggaagatccgacccgattgctattggatatctaa

DBGET integrated database retrieval system