KEGG   Tolumonas auensis: Tola_2301Help
Entry
Tola_2301         CDS       T00904                                 

Definition
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine pyrophosphokinase (EC:2.7.6.3)
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
tau  Tolumonas auensis
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tola_2301
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.6  Diphosphotransferases
    2.7.6.3  2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase
     Tola_2301
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
2523373..2523858
Genome map
AA seq 161 aa AA seqDB search
MTEVFVALGANLTEPRVQILRAIKALQQLPASELVSCSPLYSSAPMGPQDQPDYINAVAR
LNTSLAPHALLDELQRIELEQGRERKDERWGPRTLDLDLLLYGQQIIQDERLTVPHYGMT
QRAFVLVPLFDIAPQLALPDGRQLAGLVAACDRSTLFRLPD
NT seq 486 nt NT seq  +upstreamnt  +downstreamnt
atgactgaggtttttgttgctctcggggctaatctgactgaaccccgggtgcagatcttg
cgggcgattaaagcgctgcagcagctaccggcaagtgaactggtctcctgttctccgctg
tatagctcagccccgatgggaccacaggatcagccggactacattaatgccgtagcccgg
ttgaatacatcgctggccccccatgcactgctggatgaattgcaacgcattgagctggaa
caagggcgtgagcgtaaagatgagcgctggggtccgcggacactggatctggatttactt
ttgtatggacagcagattattcaggatgaacgtttgaccgtccctcattacggtatgact
cagcgggctttcgtactggtgccgttatttgacatagcaccacagctggcattaccggat
ggacgtcagttagccggactggttgctgcctgtgatcgcagtacactgttccgcctaccg
gattaa

DBGET integrated database retrieval system