KEGG   Tolumonas auensis: Tola_2392Help
Entry
Tola_2392         CDS       T00904                                 

Definition
(GenBank) ROK family protein
  KO
K00886  polyphosphate glucokinase [EC:2.7.1.63]
Organism
tau  Tolumonas auensis
Pathway
tau00010  Glycolysis / Gluconeogenesis
tau00520  Amino sugar and nucleotide sugar metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01130  Biosynthesis of antibiotics
tau01200  Carbon metabolism
Module
tau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tau_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_2392
   00520 Amino sugar and nucleotide sugar metabolism
    Tola_2392
Enzymes [BR:tau01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.63  polyphosphate---glucose phosphotransferase
     Tola_2392
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK FGGY_N BcrAD_BadFG Glucokinase Endonuc-FokI_C DUF4445
Motif
Other DBs
NCBI-ProteinID: ACQ93989
JGI: Tola_2392
UniProt: C4L9N6
Position
2619299..2620042
Genome map
AA seq 247 aa AA seqDB search
MHILGVDIGGTGIKAAVIDTRTGKLIGDHKRIPTPKPATPENIAASLSHLITESGWSGPI
GCGFPATVHHGVAYSASNIDPSWINTDAQTLFSEITGQPCFVVNDADAAGMAEMRFGAGQ
NQHGITILLTIGTGIGSAVFVNGELHPNTELGHLKFAGDIAERYCAESTRINQHLSWQEW
GTRFNEYLNHLEFVFNPDRFIIGGGIAEHMDEFQSFITTKAPVLAAQSLNQAGIIGAALF
AESQLNK
NT seq 744 nt NT seq  +upstreamnt  +downstreamnt
atgcatattttaggtgtggatattggtggtacgggcatcaaagcggcggtgatcgatacc
cggacaggcaaactgattggcgaccataaacgtattccgacgccgaaaccggccacaccg
gaaaatatcgctgccagcctgtcgcatctgatcaccgaatctggctggtcaggtccgatc
ggctgcggctttccggctacggtgcatcatggtgttgcttatagcgccagcaacatcgat
ccaagctggatcaataccgacgcacaaacgctgttttcagaaatcaccggtcagccctgc
tttgtcgttaatgatgccgatgcggccggcatggccgagatgcgctttggtgcaggtcag
aatcagcatggcattaccattctgctgactattggcaccggtatcggctcagcggtgttt
gtgaatggcgaattgcacccgaatacagagctggggcatttgaaatttgccggcgatatt
gcagaacgttattgcgctgaatcgacccgcattaatcagcatctaagctggcaggaatgg
ggaacccgctttaacgaatacctgaatcatctggaatttgtgtttaacccggatcgtttc
atcatcggtggcggcatcgctgagcacatggatgagtttcaatcatttattacgactaaa
gcaccggtactggcggctcagagtctgaatcaggcgggcattatcggggcagcattattt
gctgagagtcagttaaacaaataa

DBGET integrated database retrieval system