KEGG   Tolumonas auensis: Tola_2599Help
Entry
Tola_2599         CDS       T00904                                 

Definition
thymidine phosphorylase (EC:2.4.2.4)
Orthology
K00758  
thymidine phosphorylase [EC:2.4.2.4]
Organism
tau  Tolumonas auensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tola_2599
Enzymes [BR:tau01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.2  Pentosyltransferases
    2.4.2.4  thymidine phosphorylase
     Tola_2599
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2841406..2842737)
Genome map
AA seq 443 aa AA seqDB search
MFLPQEIIRKKRDGYALTDSEIQFFVQGITHNTVTEGQIAALAMAVFFKGMTMPERITLT
CAMRDSGSVLDWHELELPGPVLDKHSTGGVGDVVSLMLGPMVAACGGYVPMISGRGLGHT
GGTLDKFDAIPGYQTSPLKAIFKKVVKEVGVAIIGQTSDLAPADKRFYATRDVTATVESI
PLITASILSKKLAAGLEALVMDVKAGSGAFMPTYEQSEELAKSIVAVANGAGCRTTALLT
DMNQVLATSAGNAVEVREAVRYLTGAYRHPRLHEVTMALCAEMLLSGGLATNEQEARAKL
QRVLDNGKAAETFGRMVAALGGPADFVDHFDDHLEKAAVIRPVYAESAGIVGGMDTRALG
MAVVALGGGRLRATDPIDYSVGLTDVISLGEKVDKERPLAWVHARTEAQYEQTAAVIRNA
IRVGDAVATLPPAVYRRITLADV
NT seq 1332 nt NT seq  +upstreamnt  +downstreamnt
atgttccttccgcaagaaattatccgtaaaaaacgcgacggatatgcactaaccgacagt
gagattcagtttttcgttcaaggcatcacgcataacacagttactgaaggacagatcgct
gcgctggcaatggcggttttctttaagggcatgacgatgccggaacggatcacactgacc
tgcgccatgcgtgattccggttcagtgctggactggcatgagctggaattgccgggaccg
gtgctggataagcattccaccggcggtgtgggtgatgtggtctcgctgatgttaggcccg
atggttgctgcctgcggtggttatgtgccgatgatttccggccgcggcttaggacatacc
ggtggtacgctggataagtttgatgctatcccgggatatcagaccagcccgctgaaagcg
attttcaagaaagtcgtgaaagaggtcggggtggctatcattggccaaacctcggatctg
gcgccggcggacaaacgcttttatgccacccgtgatgtcactgccacagtcgaatccatt
ccattgatcactgcgtccattctgtcgaaaaaactggcggcaggactggaagcactggtg
atggatgttaaagccggctcgggtgcttttatgcctacttatgaacaatctgaagaactg
gcaaaaagtattgtcgctgtagccaatggtgccggttgccgtacgacagcgctactgacc
gatatgaatcaggtgctggcgaccagtgccggcaatgccgtcgaggtgcgggaagcggtg
cgttatctcaccggagcctatcgtcacccgcggttacatgaagtgaccatggcattgtgt
gcggaaatgctgctgtccggtggcctggcaactaatgagcaggaagcaagagccaaactg
cagagggtgctggataacggtaaagctgcagaaacatttggccgcatggtcgcagcttta
ggtggtccggctgattttgtcgatcactttgatgatcatctggagaaagccgcggttatc
cgtccggtttacgctgaatcagccggtatagtcggcggaatggatacccgggcactcggt
atggcggtggtcgcgttaggcggtggtcgcttacgtgccactgatccgattgattattcg
gtagggctgacagacgttatttctctgggtgaaaaggtggataaagaacgtccgctggcg
tgggttcatgcccgcacggaagcacaatatgaacaaacagcagcggtaattcgtaatgct
attagagtcggcgatgctgtggctactttgccaccggctgtttatcgccgcattacctta
gctgatgtttga

DBGET integrated database retrieval system