KEGG   Tolumonas auensis: Tola_2616Help
Entry
Tola_2616         CDS       T00904                                 

Gene name
aroB
Definition
3-dehydroquinate synthase
Orthology
K01735  
3-dehydroquinate synthase [EC:4.2.3.4]
Organism
tau  Tolumonas auensis
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    Tola_2616 (aroB)
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tola_2616 (aroB)
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Tola_2616 (aroB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2858657..2859733)
Genome map
AA seq 358 aa AA seqDB search
METLTVNLAERSYPIYVGAGLLTSSALFAPHIAGQRVMIVTNDTVAPLYLDVLRKTLAGY
QIDTLILPDGEAHKTLASFEVIMSALLKGTHGRDTTLIALGGGVIGDLVGFAAACYQRGV
PFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVIIDIDCLRTLPSRELAAGM
AEVIKYGIIWDADFFSWLEQHISDIQSLSPDALSKIILRCCAIKADVVAQDETENGVRAL
LNLGHTFGHAIEAEQGYGKWLHGEAVAAGTVQAAETSLRLGLLSDTDVSRIKALLKAANL
PVTAPADMTYDDYIHHMLRDKKAKAGKLRLVLPQAIGRADLFTDVEQTVLRAVIDATH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgttgacagttaatttggccgaacgtagttatcctatatatgttggagccggg
ctactgacatcttcagcactgtttgcaccgcatattgcagggcagcgggtcatgattgtg
accaacgatacagttgctccattatatctggatgtactccgtaagacgctggctggctat
cagattgatacattgattttgcccgatggtgaagcgcataaaacactcgcttcatttgag
gtaattatgtctgcgctgctgaaaggaacgcatggtcgtgatactaccctgattgcactg
ggtggtggcgtgatcggtgatcttgttggctttgctgctgcctgttaccagcgtggagtg
ccttttattcaggtaccgacaactttgttatctcaggttgattcatctgttggtggaaag
accgcagttaaccatcctcttggtaagaatatgatcggtgctttttatcagccgaaagct
gtcatcatcgatattgattgcctgcgcacgttgccatcccgtgaactggcagccggtatg
gctgaagtcatcaaatatggcatcatctgggatgctgatttcttcagttggctggaacag
catatctctgatattcagtctttgtcgccggatgcattatctaaaatcattcttcgctgc
tgtgctatcaaagcggatgttgtcgcgcaggatgaaactgagaacggcgtaagagcgttg
cttaatctgggtcatacatttggtcatgcgatcgaagctgagcagggttatggcaagtgg
ttacacggtgaggctgttgctgccggcaccgtacaggctgcagaaacatcactgcggtta
ggcttattgtctgatacggatgtttcccggattaaagccttactaaaggcagcaaatctg
cctgttactgctcctgctgatatgacatatgatgattatattcaccatatgttgcgcgat
aaaaaagcgaaagccggaaaactgcgactggtattgcctcaggctatcggtcgtgcggat
ttgtttactgacgtggagcagaccgtgcttcgcgcagttattgatgcgacacactga

  All links  
No link information was found.   
DBGET integrated database retrieval system