KEGG   Tolumonas auensis: Tola_2616Help
Entry
Tola_2616         CDS       T00904                                 

Definition
(GenBank) 3-dehydroquinate synthase
  KO
K01735  3-dehydroquinate synthase [EC:4.2.3.4]
Organism
tau  Tolumonas auensis
Pathway
tau00400  Phenylalanine, tyrosine and tryptophan biosynthesis
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01130  Biosynthesis of antibiotics
tau01230  Biosynthesis of amino acids
Module
tau_M00022  Shikimate pathway, phosphoenolpyruvate + erythrose-4P => chorismate
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Tola_2616
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.4  3-dehydroquinate synthase
     Tola_2616
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DHQ_synthase Fe-ADH_2 Fe-ADH
Motif
Other DBs
NCBI-ProteinID: ACQ94210
JGI: Tola_2616
UniProt: C4LB07
Position
complement(2858657..2859733)
Genome map
AA seq 358 aa AA seqDB search
METLTVNLAERSYPIYVGAGLLTSSALFAPHIAGQRVMIVTNDTVAPLYLDVLRKTLAGY
QIDTLILPDGEAHKTLASFEVIMSALLKGTHGRDTTLIALGGGVIGDLVGFAAACYQRGV
PFIQVPTTLLSQVDSSVGGKTAVNHPLGKNMIGAFYQPKAVIIDIDCLRTLPSRELAAGM
AEVIKYGIIWDADFFSWLEQHISDIQSLSPDALSKIILRCCAIKADVVAQDETENGVRAL
LNLGHTFGHAIEAEQGYGKWLHGEAVAAGTVQAAETSLRLGLLSDTDVSRIKALLKAANL
PVTAPADMTYDDYIHHMLRDKKAKAGKLRLVLPQAIGRADLFTDVEQTVLRAVIDATH
NT seq 1077 nt NT seq  +upstreamnt  +downstreamnt
gtggagacgttgacagttaatttggccgaacgtagttatcctatatatgttggagccggg
ctactgacatcttcagcactgtttgcaccgcatattgcagggcagcgggtcatgattgtg
accaacgatacagttgctccattatatctggatgtactccgtaagacgctggctggctat
cagattgatacattgattttgcccgatggtgaagcgcataaaacactcgcttcatttgag
gtaattatgtctgcgctgctgaaaggaacgcatggtcgtgatactaccctgattgcactg
ggtggtggcgtgatcggtgatcttgttggctttgctgctgcctgttaccagcgtggagtg
ccttttattcaggtaccgacaactttgttatctcaggttgattcatctgttggtggaaag
accgcagttaaccatcctcttggtaagaatatgatcggtgctttttatcagccgaaagct
gtcatcatcgatattgattgcctgcgcacgttgccatcccgtgaactggcagccggtatg
gctgaagtcatcaaatatggcatcatctgggatgctgatttcttcagttggctggaacag
catatctctgatattcagtctttgtcgccggatgcattatctaaaatcattcttcgctgc
tgtgctatcaaagcggatgttgtcgcgcaggatgaaactgagaacggcgtaagagcgttg
cttaatctgggtcatacatttggtcatgcgatcgaagctgagcagggttatggcaagtgg
ttacacggtgaggctgttgctgccggcaccgtacaggctgcagaaacatcactgcggtta
ggcttattgtctgatacggatgtttcccggattaaagccttactaaaggcagcaaatctg
cctgttactgctcctgctgatatgacatatgatgattatattcaccatatgttgcgcgat
aaaaaagcgaaagccggaaaactgcgactggtattgcctcaggctatcggtcgtgcggat
ttgtttactgacgtggagcagaccgtgcttcgcgcagttattgatgcgacacactga

DBGET integrated database retrieval system