KEGG   Tolumonas auensis: Tola_2697Help
Entry
Tola_2697         CDS       T00904                                 

Gene name
malQ
Definition
4-alpha-glucanotransferase (EC:2.4.1.25)
Orthology
K00705  
4-alpha-glucanotransferase [EC:2.4.1.25]
Organism
tau  Tolumonas auensis
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:tau00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(2960180..2962372)
Genome map
AA seq 730 aa AA seqDB search
MDDLLELLAKKRGIGQEYTDIWGKTTRISPENKRAILSAMGYEVSEPEVLAGQIAHDDLA
YWQQILDPVYVRRQQPEFQIVCRLPAGSDLRLSWRIEQESGEQLQGTVVITDSQKVKSFQ
YNELLFSEYSVTIQHNIPCGYHRLVLLSENEAQILAGSSLIIAPANCFHPGFIQQNQKCW
GPSVQLYSLRSQRNWGVGDFTDLKALLRGVAAWGADFVGLNPIHALYPANPGACSPYSPS
SRRWLNIIYIDVEAIPEFQANPDLRKALDAAEEQEQLAQLRAVEWVDYRAVFAFKLRWLR
QLFENSDLSTRTERGKALADYISAGGDSLLQMATFDALQNTLYAGGLDAWGPPVWPDAYR
EYNSAAVKTWIASHQLDIRFYLFLQWVADQQMAEAEQLAKGLGMKVGLYRDLAVGVSEGS
CEIWANKDLYCPKASIGAPPDPLGPQGQNWGLPPIDPVRLYQSAYQPFIELVRANMRGCG
ALRIDHVMGLRRLWWVPPGAPSSMGAYVYYPVDDLLAILALESHRQRCLVIGEDLGTVPP
EMRTLLHENGIYSYKVFFFERAQDGGFYSPSHYPEQAMSALTTHDMPTLRGFWHCDDLSL
GRDLGLYPDEEKLQDLYRERHSAKQAILDSLRWHGILPDHIEHDVSWVGMNAALSHALQV
HMGRGNSALFSTQLEDWLEMDKPVNVPGTSYEYPNWQRKLSRDLESFLNDPALAALADRL
TNARKQRQKI
NT seq 2193 nt NT seq  +upstreamnt  +downstreamnt
atggatgatctccttgagttactggcaaaaaagcgtgggatagggcaggaatacacggac
atctggggtaagacgacccggatttctccggagaataagcgggcaattctgagcgcaatg
ggatatgaggtctcggagcctgaagtattggctggacagattgctcatgatgatttggca
tactggcaacaaattctggatccggtatatgtgagacggcaacagcctgaatttcaaatc
gtctgccgtttgcctgccggctctgacctgcggctaagctggcgtattgaacaggaatca
ggagagcaattacagggcactgttgttataacggatagtcaaaaagtaaagtcgtttcaa
tataatgaattattattttctgaatactcagtgactatccagcataatattccttgtggg
tatcatagattagttcttttatctgaaaatgaagcacaaatattagcgggttcatcttta
attatcgctcctgccaattgttttcaccccggatttatacagcaaaatcagaaatgctgg
ggtccgagtgtacagctatatagtttgcgtagtcagcggaactggggggttggtgatttc
actgatcttaaagctttactgcgcggtgttgctgcctggggggccgattttgttggcctg
aaccctattcatgctttgtatccggctaatccgggtgcctgcagtccttatagtccgtct
tcccgtcgctggttgaatatcatttatattgatgttgaagccattcctgaatttcaggcc
aatcctgatctccggaaagcattagatgctgcggaagagcaggaacaattagcacaactg
cgggctgttgaatgggtcgattatcgcgctgtctttgcgttcaaactgcgctggttgcgc
caactctttgaaaattctgatttatccaccaggacggagcggggcaaagcacttgctgac
tatatctccgccggcggggacagcctgttgcagatggctacctttgatgcattacagaat
accctgtatgccggtggtctggatgcctggggtcctccggtctggcctgatgcttaccgg
gagtataactcagccgctgtaaaaacctggattgcttcacatcagctggatattcgtttt
tatctgtttttgcagtgggttgcggatcagcagatggccgaagcggaacagctggccaaa
ggtctgggcatgaaggttggcttgtatcgcgatcttgctgttggtgtttccgaagggtct
tgtgagatttgggcgaataaagatttgtattgccctaaagccagtattggtgcgccgcct
gatcctcttggtccacagggacagaactgggggttgccacccatagatccggtgcgctta
tatcaatcggcgtatcagccgtttattgagctggtacgtgccaatatgcgtggctgtggt
gcgctgcggatcgatcacgtaatgggattgcggcgtctgtggtgggtgcctccgggcgcg
ccatcgagtatgggcgcctatgtctattatccggtagatgatttacttgccattctggca
ctggaatcacatcgtcagcgttgtctggtcatcggtgaggatttaggcacggttccgcct
gaaatgcggacattgctgcatgaaaatggtatctactcttataaggtctttttctttgag
cgggcacaggatggcggattttattcaccatctcattatcctgaacaggcgatgtcggca
ttaacgacacatgatatgccgacactgcgtggcttctggcattgtgatgatctttctctg
ggccgtgatttgggtctctatccggatgaggaaaaattgcaggatctgtatcgggagcgg
catagtgcaaagcaggcgatccttgattcattacgctggcatggcattttgccagatcat
atcgagcatgatgtcagctgggttggcatgaatgccgcgttatcccatgcgctgcaggtg
catatggggcggggaaacagtgctctgttcagtacgcagcttgaagactggttggagatg
gataagccggtcaatgtgccgggtaccagttatgaatatcctaactggcaaagaaagctg
agcagggatctggagagttttttaaatgatccggcattagcagcgctggctgacagactg
actaatgcaagaaaacaacgacaaaaaatttaa

DBGET integrated database retrieval system