KEGG   Tolumonas auensis: Tola_2736Help
Entry
Tola_2736         CDS       T00904                                 

Definition
(GenBank) protein-L-isoaspartate O-methyltransferase
  KO
K00573  protein-L-isoaspartate(D-aspartate) O-methyltransferase [EC:2.1.1.77]
Organism
tau  Tolumonas auensis
Brite
Enzymes [BR:tau01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.77  protein-L-isoaspartate(D-aspartate) O-methyltransferase
     Tola_2736
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PCMT Methyltransf_31 Methyltransf_23 Methyltransf_25 Methyltransf_11 RrnaAD Methyltransf_32 MTS
Motif
Other DBs
NCBI-ProteinID: ACQ94329
JGI: Tola_2736
UniProt: C4LBQ5
Position
complement(3002486..3003112)
Genome map
AA seq 208 aa AA seqDB search
MRGTVAYLLIKQLQELGIRDERVLSAMANVPRNYFVDEAISHQAWDNTALPIGFGQTISQ
PYIVARMTEQLIQNNPQNVLEVGTGSGYQTAVLSQLIPRVYTVERIKALQYQARRRLLRL
DFHNVSMRHGDGWAGWTSKAPFDAIIVTAAAEKVPDALLAQLADGGRMVIPVGEYKQELL
LIEKYGKTIRTEVLEAVRFVPLVHGELM
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
gtgcgtggcacggtggcttatcttttaatcaaacagttgcaggaactcggcatcagagat
gaacgggtgctttctgctatggctaatgttccgcgcaactattttgtggatgaagccatc
tcccatcaggcctgggataacacagcgttaccgatcggctttggtcagacgatttcacag
ccttacatcgtagctagaatgacggaacaactgattcagaacaatccgcagaatgtgtta
gaagttggcaccggatccggttatcagactgccgtgttatctcagcttatcccgcgggtt
tacactgttgaacgaattaaagctctgcaatatcaggctcgccgccggttgctgcgcctt
gattttcataatgtctctatgcgtcacggcgatggctgggcgggatggacaagcaaagcc
ccatttgatgcaattattgtgactgcggctgctgaaaaagtccctgatgcattactggcg
cagttagctgatggtggcaggatggtgatacctgttggtgaatataagcaggaactgttg
ctgattgaaaaatatggcaaaacaatcagaacggaggtacttgaagccgttcgttttgtt
cctctggttcatggtgagttgatgtga

DBGET integrated database retrieval system