KEGG   Tolumonas auensis: Tola_2743Help
Entry
Tola_2743         CDS       T00904                                 

Gene name
pyrG
Definition
CTP synthetase (EC:6.3.4.2)
Orthology
K01937  
CTP synthase [EC:6.3.4.2]
Organism
tau  Tolumonas auensis
Pathway
Pyrimidine metabolism
Metabolic pathways
Module
Pyrimidine ribonucleotide biosynthesis, UMP => UDP/UTP,CDP/CTP
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Nucleotide metabolism
   00240 Pyrimidine metabolism
    Tola_2743 (pyrG)
Enzymes [BR:tau01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.4  Other carbon-nitrogen ligases
    6.3.4.2  CTP synthase (glutamine hydrolysing)
     Tola_2743 (pyrG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3007863..3009500)
Genome map
AA seq 545 aa AA seqDB search
MTTKYIFVTGGVVSSLGKGIAAASLAAVLEARGLKVTMLKLDPYINVDPGTMSPIQHGEV
FVTEDGAETDLDLGHYERFIRTKMSRRNNFTTGRVYSDVLRKERRGDYLGATIQVIPHIT
NAIKERVIAGAEGHDVAIVEIGGTVGDIESLPFLEAIRQLAVDIGRNNALFMHLTLVPYL
AAAGEVKTKPTQHSVKELLSIGIQPDILICRSDRAIPANERAKIALFCNVPERAVISLKD
VDSIYKIPALLKSQGLDQLVVDRFGLQCGEANLAEWEQVIYQEANPTGEVTIGMVGKYVS
LPDAYKSVNEALKHAGLKNRLSINIRYIDSQDLETKGLEVLDGLDAILVPGGFGERGVEG
KILAAQYARENKIPYLGICLGMQVALIEFARHVAGMDGAHSSEFKRDTPYPVVGLITEWI
DEEGKVEVRTEGSDLGGTMRLGSQLCHLVEGSKVRALYGSDTIQERHRHRYEVNNTLLPK
IEAAGLKVTGLSADKKLVEIVENPDHPWFVAVQFHPEFTSTPRDGHPLFEGFIQAAGEYM
KRHLN
NT seq 1638 nt NT seq  +upstreamnt  +downstreamnt
atgacgactaaatatattttcgtgacaggcggggtggtttcatccttaggtaaaggtatc
gcagcagcctcattggcagcggtcctggaagcgcgtggtttaaaagtaaccatgctgaaa
ctcgatccgtacatcaacgttgatccgggcaccatgagccccattcagcatggtgaagta
ttcgtcacggaagatggcgctgaaaccgatctggacttaggtcactacgaacgttttatt
cgtaccaagatgtcccgtcgcaataactttaccaccggccgtgtgtattccgacgtgctg
cgtaaagagcgtcgtggtgactatctgggtgcaaccattcaggttattcctcacatcact
aacgctattaaagagcgcgtgattgcaggtgctgaagggcatgatgttgcgatcgttgaa
atcggcggtactgtcggtgacatcgaatcgttaccattcctggaagctatccgtcagctg
gcagtggatatcggccgtaataacgcgctgttcatgcacctgactctggtgccatatctg
gccgctgccggtgaagtgaaaaccaaaccaactcagcactccgttaaagaattgctgtcg
atcggtattcagccagacattttgatctgccgctccgaccgcgctattcctgcgaatgaa
cgtgcgaaaatcgccttgttctgtaacgtgccggaacgcgctgttatttcactgaaagac
gttgattctatttataaaatcccggcattgctgaaatcacaaggtctggatcaactggta
gttgatcgttttggcctgcaatgtggcgaagcgaatctggctgagtgggaacaggttatt
tatcaggaagccaatccaactggtgaagtcactattggtatggtcggtaaatacgtttct
ctgccggatgcttataaatcagttaacgaagccctgaaacacgcaggtctgaaaaaccgt
ttgagcatcaatatccgctacatcgactctcaggatctggaaaccaagggtctggaagtt
ctggatggtctggatgcgatcctggttcctggtggtttcggtgagcgtggtgtcgaaggt
aagatcctggcagcacaatatgcgcgtgaaaacaagattccttacttaggtatctgtctg
ggtatgcaggttgcgctgattgaattcgcgcgccatgttgccggtatggatggtgcacat
tcttccgaatttaagcgtgatacaccttatccggtcgttggtctgatcactgaatggatc
gacgaagaaggtaaagtggaagtgcgcaccgaaggttctgatctgggcggcaccatgcgt
ctgggttcgcaactgtgtcatttggtggaaggctctaaagttcgcgcattgtatggtagc
gacaccattcaggaacgtcatcgtcatcgttacgaagtgaacaatactctgttgccgaag
atcgaagcggctggtctgaaagtcaccggtttgtctgcagacaagaaactggtagaaatt
gttgaaaaccctgatcacccatggttcgtagcagtacagttccatccggaatttacctct
acacctcgtgacgggcatcctctgtttgaaggcttcattcaggccgcaggggaatacatg
aaaagacacctaaattaa

DBGET integrated database retrieval system