KEGG   Tolumonas auensis: Tola_2800Help
Entry
Tola_2800         CDS       T00904                                 

Definition
hypothetical protein
Orthology
K02344  
DNA polymerase III subunit psi [EC:2.7.7.7]
Organism
tau  Tolumonas auensis
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
DNA replication
Mismatch repair
Homologous recombination
Module
DNA polymerase III complex, bacteria
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:tau00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:tau00240]
Genetic Information Processing; Replication and repair; DNA replication [PATH:tau03030]
Genetic Information Processing; Replication and repair; Mismatch repair [PATH:tau03430]
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:tau03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3077717..3078070)
Genome map
AA seq 117 aa AA seqDB search
MSKSILRHMHITDWQLRCPEVLPHAPSALRSKAGPVCWVVGDLPGWIDDLCLVLHLADYQ
HVLQPADLPVSLDEGDWILWSGESVTPENYPHAHQLSLSSSASAKQQLWHQICQYEN
NT seq 354 nt NT seq  +upstreamnt  +downstreamnt
gtgtcaaaatcgattttgcgtcatatgcacataactgactggcagttgcgctgtccggag
gtgttgccgcatgcgccttcggcgctcagaagcaaagccgggcccgtctgctgggtagtc
ggtgacctgccgggctggatcgatgatctttgtctggttctgcatctggccgattatcag
catgtgcttcagccagcagatttaccggtatcattagatgaaggtgactggatcctgtgg
agcggcgagagcgttacgccggaaaattatccgcatgcgcaccagctttcattaagctca
tctgcttcagcgaagcaacaactatggcatcagatctgtcagtatgaaaattga

DBGET integrated database retrieval system