KEGG   Tolumonas auensis: Tola_2910Help
Entry
Tola_2910         CDS       T00904                                 

Gene name
lacZ
Definition
beta-D-galactosidase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
tau  Tolumonas auensis
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:tau00052]
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:tau00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:tau00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3195936..3199013)
Genome map
AA seq 1025 aa AA seqDB search
MQLAQCLARRDWENPAVTSLHRLAAHTPQSSWRDLDAARKELPSDSVVSLNGDWQFSYFA
APEMVPEAWLQADLPDSNVLPVPSNWQMHGYDIPIYTNIKYPFPCTPPFVPKENPTGCYS
TTFDVSAEWLSAGQTRVIFDGVNSAFYLWCNGHWVGYSQDSRLPAEFDLTPYLQAGSNRL
AALVLRWSDGNYLEDQDMWRMSGIFRDVSLLHKPATRLANVSARPELDACYRDAQLHLQV
DVSGECAAHQVAVWLYDGDEALVCERRAIGTAAIDEKGVYHDRLLLSLPVKAPRLWSAEE
PNLYRLVVALETNDGVLVEAEACDVGFRSVEIKNGLLLVNGKAVLIRGANRHEFHPERGQ
AVRPEDMLQDLLLMKRYNFNAVRTSHYPNHPYWYQLCDRLGLYVVDEANIETHGMTPMSR
LSDDPLWVGAFTERVTRMVQRDFNHPSIIIWSLGNESGHGAVQDSMYSWVKSRDPSRPVQ
YEGGGSDTAATDIVCPMYARVDEDQPFPAVPKWAIKKWIGMPGEARPLILCEYAHAMNNS
LGGFARYWQAFRQYPRLQGGFVWDFVDQGISRISADGKPYWAYGGDFGDTPNDRQFCLNG
VFFPDRTPHPSLYEVQKAQQFFQFKLLSTSPLKIEVSSEYLFRHSDNEQLRWQIMQQGER
KASGEQALSVGPEGTIMLTLSEQLPPLTAGIEAWLDVSVHMLHDTPWAEAGFAVAKEQWP
LPVALAAPVCEHHAAEITPLLEDKGDKWQISAGEQCWWLDKQSGLLTDWQQAGRALLLSP
LQEQFVRAPIDNDIGASEADHVDPNAYIARWQAAGLNQLQDRCFSVQTYQSSDGVVIQVE
RGHFHAERLLLRSLWQYHFTARGELQLNITTQVAEGLPSLARIGMVLHLDEQSDQVNWFG
RGPHENYPDRQTSAHIGYWQLPLAELHTPYIFPCENGLRCDTRELQLGGLQVSGQFHFRV
SPFSTRQLADTRYQYQLQAEDGLFLHLDGFHMGIGGDDSWSPSVHPDYQLGAGTYRYQVT
LKYQA
NT seq 3078 nt NT seq  +upstreamnt  +downstreamnt
atgcaactggctcagtgtctggcgcgtcgtgattgggaaaatccggcggttacctctctg
catcgtctggcggctcatacgccgcaatccagttggcgtgatttggatgcagcccgcaag
gaattaccatcggactcagttgtcagcctgaatggtgactggcagttcagttactttgct
gcgccggaaatggtgccggaggcatggttacaggcggatttgcctgacagcaacgtgctg
ccggtgccatcgaactggcagatgcatggctatgacattcctatctacaccaatattaaa
tacccgtttccctgcactccgccgtttgtgccgaaagaaaatccgaccggttgttattcc
acaacctttgatgtttccgcggaatggctgagtgctggccagacccgcgttatttttgat
ggtgtcaattcagcgttctatctctggtgtaatggtcactgggtagggtattcgcaggat
agccgtttaccggcggaatttgatttaaccccttatctgcaggcgggaagtaaccggctg
gccgcgctggtattgcgctggtctgatggcaattatcttgaagatcaggatatgtggcgc
atgagcgggattttccgcgatgtgtcactgctgcataaaccggcgacccggctggccaat
gtatctgcccgtccggagctggatgcctgttaccgtgatgcacaattacatctgcaggtg
gatgtcagcggcgaatgtgcggcacatcaggtggcagtctggttgtatgacggtgacgaa
gcactggtgtgcgagcgccgggcgatcggcaccgccgcgatcgacgaaaaaggggtctat
cacgatcggttgttactgtcgctgccggtaaaagcaccgcgtttatggtcggcggaggag
ccgaatctgtaccggttggtggtcgccctggaaacaaacgatggcgtgctggtggaggcc
gaagcctgtgatgtcggtttccgcagtgtggaaatcaagaacggtttgctgctggtcaat
ggcaaggcagtactgatccgtggtgccaaccggcatgagtttcatccggagcgcggacag
gcggtacgtccggaggatatgctgcaggatttgctgctgatgaagcgctataacttcaat
gcggtacgcacttcgcattacccgaatcatccttactggtatcagctctgtgaccgcctc
ggtttgtatgtggtggatgaagccaatatcgaaacgcatggcatgacgccgatgagccgt
ctgtcggacgatccgctctgggtgggcgcgtttaccgaacgtgtcacccgcatggtgcag
cgcgattttaaccatccgtcgatcatcatctggtcgctggggaatgaatccggtcatggc
gcagtgcaggacagcatgtacagctgggtgaaatcacgtgatccgagccgtccggtacag
tatgaaggcggtggttcagataccgccgcaaccgacattgtctgcccgatgtatgcgcgg
gtggatgaggatcagccattcccggccgtgccgaaatgggcgattaaaaagtggatcggt
atgccgggtgaagcgcggccgctgatcctctgcgaatacgcacatgcgatgaataacagc
ctcggtggctttgcccgttactggcaggcattccgccagtatccgcgtctgcagggcggc
tttgtctgggattttgtcgatcagggcatcagccgcatcagtgcggacggtaagccttac
tgggcctatggcggtgatttcggtgataccccgaatgatcgtcagttctgcctgaacggc
gtgttcttcccggatcgcaccccgcatccgtcgctatacgaagtacagaaggcgcagcaa
ttcttccagtttaaactgctttccacttcaccactgaaaatagaggtcagtagcgaatat
ctgttccgtcattccgataatgaacagttgcgctggcaaatcatgcagcagggagagcgg
aaggcctccggcgagcaggcattatcagtcgggccggaaggcacaatcatgctgaccctg
agcgagcagttaccaccgctgaccgcaggcatcgaagcctggctggatgtttcggtgcat
atgctgcacgatacgccgtgggcagaagccggctttgcggtagccaaagagcagtggcca
ttaccggtggcgctggctgctccggtctgcgaacaccatgctgcagagattacaccgctg
ctggaagacaaaggcgataaatggcagatctcggctggtgaacagtgctggtggctggat
aaacagtccggtctgctgaccgactggcagcaagccggacgcgcgttgttgctgtcaccg
ctgcaggagcagtttgtccgggcgccgattgataatgatatcggtgccagtgaagcggat
catgttgatccgaatgcctatattgcccgctggcaggcagccggactgaatcagctgcag
gatcgttgtttctccgtacagacgtatcagagttccgatggtgtggttattcaggtggag
cgcgggcattttcatgcagaacgattattgctccgctctctctggcaatatcattttacg
gcacggggtgagttgcagctgaacattaccacccaggtggcagaaggtttgccatcactg
gcgcgtatcggcatggtgctgcatctggatgagcaaagtgatcaggtgaactggtttggt
cgcggcccgcatgagaactatccggatcgtcagacatccgcgcacattggctactggcaa
ttgccattagccgaactgcatacgccgtatattttcccgtgtgagaatggtctgcgttgc
gacacgcgtgaactgcaactgggcggcctgcaggtcagcggccagttccatttccgggtc
agcccgttcagtacccgacagctggcggatacgcgttatcagtatcagctacaggcagaa
gacggtttgttcctgcatctggacggcttccatatggggatcggcggtgatgactcctgg
agcccgagtgtacatcccgattatcagctgggggcggggacgtatcgctatcaggtgacg
ctgaaatatcaggcgtaa

DBGET integrated database retrieval system