KEGG   Tolumonas auensis: Tola_2991Help
Entry
Tola_2991         CDS       T00904                                 

Definition
endonuclease IV (EC:3.1.21.2)
Orthology
K01151  
deoxyribonuclease IV [EC:3.1.21.2]
Organism
tau  Tolumonas auensis
Pathway
Base excision repair
Class
Genetic Information Processing; Replication and repair; Base excision repair [PATH:tau03410]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
complement(3277880..3278719)
Genome map
AA seq 279 aa AA seqDB search
MKYIGAHVSAAGGIELAVERAVAIGANAFALFTKNQRQWHAPDLTAKTILAFRTACETAG
FLPEQILPHDSYLINLGHPEPEALEKSRVAFIDEMQRCEQLGLCYLNFHPGSHLKAISEE
ESLRRVAESINIALDQTQGVTAVIENTAGQGTNLGWQFEHLAAIIDQVEDKSRVGVCYDT
CHAFAAGYDMRTEADCIATFAEFERVVGFNYLKGMHINGAKCTFGSRVDRHHSLQEGNLG
TAVFEFIMRDSRFDRIPLILETVNPDIWPDEIRWLRQLG
NT seq 840 nt NT seq  +upstreamnt  +downstreamnt
atgaaatacattggagctcatgtcagcgctgctggcggaattgaactggcggtagaacgg
gcggtagcgatcggcgccaatgcattcgctttgtttaccaaaaatcagcggcaatggcat
gcgccggatctgacggcaaaaacgattttggcatttcgcactgcctgtgaaacagcgggt
tttctgccggaacagatcctgccgcatgattcttatctgattaatctggggcatccggaa
ccggaagcgctggagaaatcccgggtagcgtttattgatgagatgcaacgttgtgaacag
ctcgggctgtgttatctgaactttcatcccggcagtcatctgaaggcgatcagtgaagaa
gagagtctgcggcgcgttgcagagtcgatcaatatcgcgctggatcagacgcagggggtt
accgccgtcattgaaaacaccgctgggcagggtaccaatctgggttggcagtttgaacat
ctggcggcgattatcgaccaggtcgaggataaatcccgggtcggggtttgctatgacacc
tgtcatgcctttgctgccggttatgatatgcgcacggaagcggattgcattgccaccttt
gccgaatttgaacgggtagtcggatttaactatctgaaaggcatgcatattaacggtgcg
aaatgtacgttcggcagccgcgtggatcgtcaccacagcctgcaggaaggtaatctgggt
acggcggtatttgaattcatcatgcgtgacagccgttttgaccgtattccattgattctg
gagacggtaaatccggatatctggccggacgagatccgctggttgcgccagctaggataa

DBGET integrated database retrieval system