KEGG   Tolumonas auensis: Tola_3057Help
Entry
Tola_3057         CDS       T00904                                 

Definition
alkaline phosphatase (EC:3.1.3.1)
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
tau  Tolumonas auensis
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    Tola_3057
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    Tola_3057
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Tola_3057
Enzymes [BR:tau01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     Tola_3057
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Tola_3057
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3347388..3348761
Genome map
AA seq 457 aa AA seqDB search
MLKPLLLSCAIAAALTSSLTYAAPAKNVIFFLGDGMGPTTLTAARIYKYGEEGNLQMQNL
PYTARLKTYSNDAQTTDSAPSMAAYMTGVKMNNEVISMSADTTAVAPGKDSNGNKTLNNC
TTENGTAATTLLELAKAQGKGTGSVTTTELTHATPAATFAHICHRDTQYEIATQAVPGGA
GFNSALGDGVDVLMGGGANHWTPYSATNTKGRADGRDLTAELQTHGYSYVTDKTALQTID
SSQTSKVLGLFSKTSHLAYELDRVADSTNTQPSLAEMTAKAIDILSKNDKGYFLMVEGGR
IDHALHGTNAKRALEDTVALDEAVKTALAKVDLTDTLIVVTADHDHTMTMNGYSAKGNPI
LGLVADKDGNQATDVDGRPYTTLVFGNGSNRQATRPDLTSEQVQADDYLQEAGIRLSSET
HGGGDVMLFANGAGANSFKGTMENTAVFSLVKSAAGY
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgctgaaaccattattactaagctgtgcgatcgctgcggcgttaaccagctctctgacg
tatgccgctccggccaaaaacgttattttctttcttggtgatggtatgggcccgaccaca
ctgacggccgcccgcatctacaaatatggcgaagagggtaatctgcagatgcaaaatctg
ccctataccgcccgtctgaaaacgtattccaatgatgcccagaccaccgactccgcgccg
tccatggcggcgtatatgaccggcgtcaagatgaacaatgaagtcatctcgatgagcgcg
gacaccacggcagtggcaccgggcaaagacagtaacggcaataaaaccctgaataactgc
acgaccgagaacggaacggcagccactaccctgctggagctggccaaggcgcagggcaaa
ggcaccggctcggtaaccaccaccgaactgacgcatgccacaccggcggcgacattcgcc
cacatctgccaccgtgatacacaatatgagatcgccacgcaggccgttcccggcggtgca
ggctttaacagtgcactcggtgatggcgttgatgtgctgatgggtggcggtgccaatcac
tggacgccgtattctgccaccaataccaaaggccgtgccgatggccgtgatctgacggct
gaactgcagactcacggttatagctatgtcacggataaaaccgccctgcagaccatagac
agcagccagaccagcaaggtactgggtttgttcagtaaaacctcacatctggcgtatgag
ctggatcgtgtcgccgacagcaccaatacacaaccttcgctggccgaaatgaccgcgaaa
gcgatcgatatcctgtcgaaaaatgacaagggttatttcctgatggtggaaggtggccgt
atcgaccacgcactgcacggcaccaatgccaaacgtgcgctggaagataccgtggcgctg
gatgaggcggtcaaaaccgcgctggcgaaagtcgatcttaccgatacgctgattgtggtt
accgctgaccatgaccacaccatgaccatgaatggttactctgcgaaaggaaacccgatc
ctgggtctggtggcggataaagatggcaatcaggcgaccgatgtcgatggtcgtccttat
accacgctggtattcggtaacggcagcaaccgtcaggcaacccgccctgatctgaccagc
gagcaggtacaggcggatgattatctgcaggaagccggcatccgtttatcctctgaaacc
catggcggcggcgacgtgatgctgtttgccaatggtgccggtgccaacagcttcaaaggc
acgatggaaaataccgcggtcttctcattagttaaatcagccgccggttattaa

DBGET integrated database retrieval system