KEGG   Tolumonas auensis: Tola_3101Help
Entry
Tola_3101         CDS       T00904                                 

Definition
(GenBank) glycoside hydrolase family 1
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
tau  Tolumonas auensis
Pathway
tau00010  Glycolysis / Gluconeogenesis
tau00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_3101
   00500 Starch and sucrose metabolism
    Tola_3101
Enzymes [BR:tau01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     Tola_3101
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase DUF4038 Acetyltransf_7
Motif
Other DBs
NCBI-ProteinID: ACQ94689
JGI: Tola_3101
UniProt: C4LDS8
Position
complement(3396887..3398293)
Genome map
AA seq 468 aa AA seqDB search
MTGKFPKNFLWGGAIAANQVEGAYNVDGKGLSVADVMPRGILNSEPVLDGKLGDFPYHTA
IDFYHTYKDDNALFAEMGFNCLRLSIGWSRIFPNGDDAEPNEAGLQYYDDVFDDLLSKGM
QPVITLNHYDLPLGLVTKYGGWRSRELITQYERYCKTVFARYKEKVKIWMTFNEINCVLH
APFTAAGLLIEEGENKLQLQFQAAHHQLVASALAVKACHEIIPDAKIGCMIAAWPTYPDT
CNPDDTLKAMAKDRQMLLFGDVQARGYYPSYAKRLFRENGFEIDMATGDEAILKQYAVDY
VAFSYYMSQVESADPDRREKTGGNLMGGLMNPYLKASEWGWQIDPKGMRIILNQLYDRYQ
KPLFIVENGLGAIDTVNADDSINDDYRIDYLRDHLQQVAEGIADGVELMGYTTWGPIDLV
SASTGEMKKRYGFIYVDKDNEGQGTGRRLRKKSFYWYKDVIATNGNEL
NT seq 1407 nt NT seq  +upstreamnt  +downstreamnt
atgactggtaagtttccgaaaaatttcctctggggtggtgcgattgctgccaaccaggtt
gaaggtgcttataacgttgatggtaaagggttatcggttgcggacgtcatgccgcgcggc
attctgaattctgagccggtattagacggcaaactcggtgatttcccttaccacaccgcg
atcgatttctatcacacctacaaagatgataatgcactgtttgccgagatgggctttaac
tgcctgcgtctctctatcggctggtcacgtattttcccgaatggcgatgacgccgaaccg
aatgaagccggtctgcaatattatgatgacgttttcgatgatctgctgagcaaaggcatg
cagccggttattacgctgaaccactatgacttaccgctgggtttagtgaccaaatacggc
ggctggcgcagtcgtgagctgattacacagtacgaacgttactgcaaaaccgtatttgcg
cgttacaaagagaaagtcaaaatctggatgacgttcaatgaaatcaactgtgtactgcat
gcaccgtttactgccgccggtttgctgattgaagaaggcgaaaacaaactgcagttacaa
tttcaggcggcgcatcatcagctggttgccagtgcactggccgtcaaagcctgtcatgaa
attattccggatgccaaaatcggctgcatgattgcggcatggccaacttacccggatacc
tgtaacccggacgatacgctgaaagcgatggcgaaagatcgccagatgctgctcttcggt
gacgtacaagcacgcggttattatccgtcgtatgcgaaacgtctgttccgtgagaacggc
tttgaaattgacatggcgaccggtgatgaagcgatcctgaagcagtacgctgtggattat
gtcgcgttcagttattacatgagtcaggtagaaagtgccgatccggatcgccgcgagaaa
accggcggtaacctgatgggtggcctgatgaacccgtatctgaaagcctccgaatggggc
tggcagatcgacccgaaaggcatgcgtatcatcctgaaccagctgtatgaccgttatcag
aaaccgctgtttatcgtggaaaatggtctgggtgcgattgataccgttaatgctgatgat
tccattaacgatgattaccgtatcgattatctgcgtgaccacctgcaacaggttgcagaa
gggatagcagatggtgtagaactaatgggatataccacctgggggcccattgatctggtg
agtgcttcgaccggtgaaatgaaaaaacgttatggttttatttatgtggataaagataat
gaaggtcagggtaccggccgtcgtctgcgtaaaaagagcttctactggtacaaagacgtc
attgctacgaatggaaatgaactctga

DBGET integrated database retrieval system