KEGG   Tolumonas auensis: Tola_3128Help
Entry
Tola_3128         CDS       T00904                                 

Definition
uroporphyrinogen III synthase HEM4
Orthology
K01719  
uroporphyrinogen-III synthase [EC:4.2.1.75]
Organism
tau  Tolumonas auensis
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Heme biosynthesis, glutamate => protoheme/siroheme
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    Tola_3128
Enzymes [BR:tau01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.75  uroporphyrinogen-III synthase
     Tola_3128
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3426889..3427614
Genome map
AA seq 241 aa AA seqDB search
MTPLILRPQPAAGELAAYLRRDGHTPVVCPLLTYQPGDELALLPALLKQAEITLAVSAAA
VQFASRHLQQQKILWPPALTYLAVGPATAAEWQQQGLRVISPADARSEGLLAQPALQSVN
GKKIVILRGNGGRELLTETLRHRGAQVSCVECYRRHYLQTDGARLLQEWQAAAVDSVIIT
SSELFRQLLILLPDTAGNWLSALRWFVASERIAEEIRHSGFKQITIMSGAQHQAVAAALS
E
NT seq 726 nt NT seq  +upstreamnt  +downstreamnt
atgacaccgttaatcctgcgtccgcagcctgccgccggtgaactggcggcatatttgcgg
cgtgacggccacacaccggtagtctgcccgttactgacttaccagccaggcgatgagtta
gccttattaccagccctgctgaagcaggcggagatcaccctcgcggtgagtgccgctgcc
gtacaatttgccagccgccacttacagcaacaaaaaattctgtggccaccagcgctgact
tatctggcggtcggcccggcgacggcagccgaatggcagcaacaagggctccgcgtcatc
tcgcctgccgatgcccgcagcgaaggtttgctggcgcagcccgcactgcaatcggttaac
ggaaagaaaatcgtgatcctgcgcggtaacggtggccgcgaactgctgacggaaacctta
cgccaccgcggtgcgcaggtttcctgtgttgaatgttaccgtcgtcactatctgcaaaca
gacggcgcccgtttattacaggaatggcaggcagccgcggtggacagtgttatcatcact
agtagtgaattatttcggcaattactgatcctgttacccgataccgccggaaattggtta
tcagcactacgctggtttgttgccagcgaacgcatcgcggaagagatcaggcattcagga
tttaaacaaataacgattatgtccggcgcacagcatcaggctgtggcggctgcattatca
gaataa

DBGET integrated database retrieval system