KEGG   Tolumonas auensis: Tola_3162Help
Entry
Tola_3162         CDS       T00904                                 

Definition
(GenBank) triosephosphate isomerase
  KO
K01803  triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tau  Tolumonas auensis
Pathway
tau00010  Glycolysis / Gluconeogenesis
tau00051  Fructose and mannose metabolism
tau00562  Inositol phosphate metabolism
tau01100  Metabolic pathways
tau01110  Biosynthesis of secondary metabolites
tau01120  Microbial metabolism in diverse environments
tau01130  Biosynthesis of antibiotics
tau01200  Carbon metabolism
tau01230  Biosynthesis of amino acids
Module
tau_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
tau_M00002  Glycolysis, core module involving three-carbon compounds
tau_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_3162
   00051 Fructose and mannose metabolism
    Tola_3162
   00562 Inositol phosphate metabolism
    Tola_3162
Enzymes [BR:tau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tola_3162
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tola_3162
  Exosomal proteins of bladder cancer cells
   Tola_3162
  Exosomal proteins of melanoma cells
   Tola_3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TIM
Motif
Other DBs
NCBI-ProteinID: ACQ94750
JGI: Tola_3162
UniProt: C4LDY9
Position
3458797..3459582
Genome map
AA seq 261 aa AA seqDB search
MKKKLVGTSWKMNKTLSEALAFCHVLKSGLSKEICESIQPFVIPPFTTVRDVSLFINENQ
INCLTGVQNMHFADQGAYTGEISPLMVKDTGAVLVELGHSERRHYFAETDLMVNKKVHAA
INHGLKPLVCVGDEAQEKEWGVSVETVVKQMKAAIAGLSAAQVENVIIAYEPVWAIGEHG
IPATTEEAEVIHAALRQALITCYGEQVANKISILYGGSVNLQNSVELITQPNIDGLFIGR
SAWSPEGYCEILSTISRIIRD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaattagttggcactagctggaaaatgaataaaacactgtcagaagctctg
gcgttttgtcatgtattgaagtcaggcttgtcaaaagaaatatgtgaaagtattcaacca
tttgtgataccaccattcactacggtcagagatgtatccttattcatcaatgaaaaccag
atcaattgtctgactggtgtacaaaatatgcatttcgctgatcagggcgcgtacaccgga
gagatatctccgttaatggtcaaggacaccggtgctgtgttggttgaactcggtcattcg
gaaagaaggcactatttcgccgaaaccgatctgatggtgaataaaaaagttcatgcggca
attaaccatggactcaagcccctggtttgtgttggtgacgaagcacaggaaaaagaatgg
ggtgtttctgtcgaaactgttgtcaaacaaatgaaagcagctatcgcgggtctcagcgct
gctcaggttgagaacgttattattgcttatgagcctgtatgggcaattggcgaacacgga
ataccagcaacaaccgaagaagcagaagtgattcatgctgcattacgacaagccctgata
acttgttacggcgaacaagttgcaaataaaatatcaattctctatggcggaagtgttaac
cttcagaattcggtagaattaataactcaaccaaacattgatggtttgtttattgggcgc
tcagcctggagccctgaaggctattgtgaaatcctgtcaacaatatccagaatcatccgt
gattag

DBGET integrated database retrieval system