KEGG   Tolumonas auensis: Tola_3162Help
Entry
Tola_3162         CDS       T00904                                 

Definition
triosephosphate isomerase
Orthology
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
tau  Tolumonas auensis
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:tau00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    Tola_3162
   01230 Biosynthesis of amino acids
    Tola_3162
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Tola_3162
   00051 Fructose and mannose metabolism
    Tola_3162
   00562 Inositol phosphate metabolism
    Tola_3162
Enzymes [BR:tau01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     Tola_3162
Exosome [BR:tau04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   Tola_3162
  Exosomal proteins of bladder cancer cells
   Tola_3162
  Exosomal proteins of melanoma cells
   Tola_3162
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
Position
3458797..3459582
Genome map
AA seq 261 aa AA seqDB search
MKKKLVGTSWKMNKTLSEALAFCHVLKSGLSKEICESIQPFVIPPFTTVRDVSLFINENQ
INCLTGVQNMHFADQGAYTGEISPLMVKDTGAVLVELGHSERRHYFAETDLMVNKKVHAA
INHGLKPLVCVGDEAQEKEWGVSVETVVKQMKAAIAGLSAAQVENVIIAYEPVWAIGEHG
IPATTEEAEVIHAALRQALITCYGEQVANKISILYGGSVNLQNSVELITQPNIDGLFIGR
SAWSPEGYCEILSTISRIIRD
NT seq 786 nt NT seq  +upstreamnt  +downstreamnt
atgaagaagaaattagttggcactagctggaaaatgaataaaacactgtcagaagctctg
gcgttttgtcatgtattgaagtcaggcttgtcaaaagaaatatgtgaaagtattcaacca
tttgtgataccaccattcactacggtcagagatgtatccttattcatcaatgaaaaccag
atcaattgtctgactggtgtacaaaatatgcatttcgctgatcagggcgcgtacaccgga
gagatatctccgttaatggtcaaggacaccggtgctgtgttggttgaactcggtcattcg
gaaagaaggcactatttcgccgaaaccgatctgatggtgaataaaaaagttcatgcggca
attaaccatggactcaagcccctggtttgtgttggtgacgaagcacaggaaaaagaatgg
ggtgtttctgtcgaaactgttgtcaaacaaatgaaagcagctatcgcgggtctcagcgct
gctcaggttgagaacgttattattgcttatgagcctgtatgggcaattggcgaacacgga
ataccagcaacaaccgaagaagcagaagtgattcatgctgcattacgacaagccctgata
acttgttacggcgaacaagttgcaaataaaatatcaattctctatggcggaagtgttaac
cttcagaattcggtagaattaataactcaaccaaacattgatggtttgtttattgggcgc
tcagcctggagccctgaaggctattgtgaaatcctgtcaacaatatccagaatcatccgt
gattag

DBGET integrated database retrieval system