KEGG   Treponema azotonutricium: TREAZ_0073Help
Entry
TREAZ_0073        CDS       T01506                                 

Definition
UDP-N-acetylmuramoylalanyl-D-glutamate--2,6-diaminopimelate ligase (EC:6.3.2.13)
Orthology
K01928  
UDP-N-acetylmuramoyl-L-alanyl-D-glutamate--2,6-diaminopimelate ligase [EC:6.3.2.13]
Organism
taz  Treponema azotonutricium
Pathway
Lysine biosynthesis
Peptidoglycan biosynthesis
Brite
KEGG Orthology (KO) [BR:taz00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    TREAZ_0073
  Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    TREAZ_0073
Enzymes [BR:taz01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.13  UDP-N-acetylmuramoyl-L-alanyl-D-glutamate---2,6-diaminopimelate ligase
     TREAZ_0073
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2405924..2407636
Genome map
AA seq 570 aa AA seqDB search
MSAGKRNNPYARNFKEFFTSQLAEKAGIVGTRYGGENDPLITGLEYDSRKVKPGFIYFAL
PGLHADGHAFIPEAEKWGASVIVHQDELKEFREWVTYIRVKDSRFAMSPIADAFYNHPSR
HMAVVGVTGTEGKSTTVYLIHQLLGLLGLRSGFISTVMQGDGKTDFCNPEHQTTPEAVTI
HKLLADMKRNDADFAVVESSSHGLSKRTNRLGDVVFDVGVMTNVTHEHLEFHGTWEQYRS
DKAELFRSLDAAPDHAKLDQKNQQPRRKTDEVYYPQKVLHSELNALVSVPSFGVVNADDP
SADFFAEATKHKTYSYSVRGADADLSLKIIESSAWGNWYEVHAAATGEDLIIRDQLPGAF
NAGNVLASLLVVSNLLSKDIKDLIPLIPYLKPVRGRMTAISKGQPFEVMVDYAHTPSSFE
TIFPPLRERLNASGGRIISLFGSAGERDTRKRPEQGRIAAAYSDIVVLCDEDPRGEDPVA
ILEEIAQGCVADQGCKTDQGAGDSKTVNKDLFLIPDRPEAIRKAFSLAKPGDLVLLLGKG
HENSIIYKDGKIDYDEISEAEKALDELKNN
NT seq 1713 nt NT seq  +upstreamnt  +downstreamnt
atgagcgccggtaaaaggaacaacccttacgccaggaattttaaggaatttttcacatcc
cagcttgccgaaaaggcgggtatagtcgggacccgttacggcggggagaacgatcctctt
attaccggcctggagtacgactcccgcaaggttaagccagggtttatttattttgccctc
cccgggctccacgccgacggccatgcctttatccccgaggccgagaaatggggcgcctcg
gttatcgtccatcaggatgagctcaaagaattcagggaatgggttacatacataagggta
aaggattcccgctttgccatgtcccccatagcggacgccttctataatcacccctcgcgg
cacatggctgtcgtaggggtcacaggcaccgaggggaaaagcaccacggtctatcttatc
caccagcttctgggccttttggggctcaggtcgggctttatctccacggtcatgcagggg
gatgggaaaaccgacttctgcaatcctgaacaccagaccaccccagaggcggtaaccatc
cataaacttttggccgacatgaaacgcaatgacgcggactttgcggtagtggagtccagt
tcccacggcctctcaaaacggaccaataggctgggggatgtggtcttcgatgtgggggtc
atgaccaacgtaacccatgagcatctggaatttcacggcacctgggaacagtaccggagc
gacaaggctgaacttttccgttctttggatgctgccccggatcatgcaaagctggatcag
aaaaatcagcagccccgccgcaaaacggacgaggtatattatccacaaaaggtattgcat
tcggagctcaatgcccttgtgtcggtgccgtctttcggcgtggttaatgccgatgatccc
agcgcggatttttttgccgaggctacaaaacacaaaacctacagctacagtgtgcgcggg
gcggatgcggacctctcccttaaaattattgaaagcagcgcctggggcaactggtacgaa
gtccatgcagcagccactggcgaagatctcattatacgggatcaattgcccggggctttc
aatgcagggaatgtgttggcaagcctcctggtagtttccaacctcctttctaaagacata
aaagacctgattccccttatcccctacctcaagcccgtaaggggcaggatgaccgctatc
agcaaaggccagccttttgaagtgatggtggattatgcccataccccgtcgtctttcgaa
accatattccctcccctgcgcgaaaggctcaacgcctcaggcggcaggatcataagcctc
tttggatcagccggggaacgggacaccaggaagcgccccgagcagggccgaattgccgct
gcctattccgacatagtggtactctgcgacgaagatccccggggcgaagatcccgtggct
atactcgaagagatagcccagggctgcgtagcagaccagggctgcaaaacagaccaggga
gccggtgacagtaaaactgtcaacaaggatctcttcctcattcccgacaggccagaagcc
atacgcaaagccttctcccttgcaaaaccaggggatctggttttgctgctgggcaagggg
cacgagaattcaattatctataaagacgggaaaatagattacgacgaaatatccgaggcg
gaaaaagccctggacgaattaaaaaacaactag

DBGET integrated database retrieval system